Details for Capsella Locus Carubv10013721m

Position : scaf_3 ( 5`- 2968131 .. 2969819 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013721m

Protein [Map View]
MTRSPFFFVLLLLFAACIITRTAAEIKSLTISDDSRPMILFEKFGFTQSGHVSVAVSSVSVVSSSSALIPDPSRLGFFLM
SEESLLQVVLEIQQNPNFCVLDSNYVLHLFTFHDLSPPPGSKYEHLYPVISPNEYSLFFVNCVPETKISMKVRTEMYNLD
PNGSKDYLPAGSTRLPGLYFFFSLGYLAFLGLWGYACFVNKRVVHRIHVLMAALLLMKALNLICAAEDKHYVKVTGTPHG
WDVLFYIFQFLRVVLLFTVIVLIGTGWSFLKPFLQEKEKNVLMVVVPLQVLANIASIVIGETGPFIKDWVTWNQIFLLVD
IVCCCAILFPIVWSIRSLRETSKTDGKAARNLAKLTLFRQFYIVVIGYLYFTRIVVFALKTIAAYKYRWVSNAAEEIASL
AFYMLMFYMFRPVEKNEYFVLDEEDEEAAELALKEDDFEL*

DNA
ATGACGAGATCACCCTTCTTCTTCGTCCTCCTACTCCTCTTCGCCGCATGTATCATCACTCGCACGGCGGCGGAGATCAA
GTCTCTCACAATCTCCGACGACTCTAGGCCGATGATTCTCTTTGAGAAATTCGGATTCACTCAGTCCGGCCATGTTAGCG
TCGCTGTTTCCTCCGTATCTGTAGTATCTTCTTCGTCTGCCCTGATCCCTGATCCTTCGAGGCTAGGCTTCTTCCTCATG
TCAGAGGAATCGCTTCTCCAAGTAGTCTTAGAGATCCAGCAAAACCCTAACTTCTGTGTACTCGATTCCAATTACGTCCT
CCACCTCTTCACATTCCACGATCTCTCTCCTCCGCCTGGTTCCAAATACGAGCACTTGTACCCGGTGATTTCTCCCAACG
AGTACTCTCTCTTCTTCGTGAATTGCGTCCCCGAAACCAAAATTTCGATGAAGGTTCGAACGGAGATGTACAATTTAGAT
CCGAACGGCTCTAAGGATTACCTCCCTGCCGGTTCTACCCGATTACCGGGATTGTATTTCTTCTTCTCTCTCGGCTACTT
AGCTTTCCTTGGTCTCTGGGGTTATGCTTGTTTTGTCAATAAAAGAGTTGTCCACCGTATCCATGTTCTCATGGCCGCTT
TGCTTCTGATGAAGGCTCTGAATCTGATCTGTGCCGCCGAGGATAAACACTACGTGAAAGTCACCGGTACTCCCCACGGC
TGGGATGTCTTATTCTACATTTTCCAGTTTCTTCGCGTTGTTCTTCTCTTCACTGTGATTGTCTTGATCGGAACTGGTTG
GTCCTTCTTGAAGCCATTCTTACAAGAGAAAGAGAAGAACGTGTTGATGGTTGTTGTTCCACTTCAGGTTTTGGCCAACA
TAGCTTCCATTGTGATTGGAGAGACTGGACCTTTCATCAAAGATTGGGTTACTTGGAATCAGATTTTCTTACTTGTAGAT
ATAGTTTGCTGTTGTGCTATCTTATTCCCCATTGTTTGGTCGATACGTTCGCTGAGAGAGACTTCGAAAACCGATGGGAA
AGCAGCTAGGAATTTGGCAAAATTGACCCTGTTTAGACAATTCTACATTGTTGTCATTGGGTATTTGTACTTTACGAGGA
TTGTAGTGTTTGCGCTGAAGACAATTGCAGCTTATAAGTATCGGTGGGTGAGCAATGCAGCTGAGGAGATTGCAAGTTTG
GCGTTTTACATGTTGATGTTCTATATGTTCAGGCCGGTTGAGAAGAATGAGTATTTCGTTTTAGATGAAGAAGATGAGGA
AGCCGCAGAGTTGGCCTTGAAGGAAGATGATTTTGAACTCTGA