Details for Capsella Locus Carubv10013712m

Position : scaf_3 ( 5`- 638395 .. 640965 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013712m

Protein [Map View]
MTISGNFFFGYFATFFFLLFLSPAQSYDYGSGLESLARGMLESAKDPEFFEWMRGIRRRIHEHPETGFQEFNTSQLVRDE
LDSLGVMYKWPVAKTGVVAWIGSGSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAAKLLQTRKH
LIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGIGSRPGTVLAGAGLFTVTVHGQGSHAATPHFS
KDPVLAASSAVVALQQIVSREMDPLEAGVVTVGYIEGGHAQNVIPQSAKFGGTFRSLSNDGLLFIQRRIKEISEAQASVY
RCRAEVNFEEKKPSLHPVMMNDKGLYEHGKKVAEAMIGESNFHDFPVTMGGEDFSFFTQKTKAAIFVLGIKNETLGAGKP
LHSPYFFVDEEALPVGAALHAAMAVSYLDKHGHVHNDEVKSEL*

DNA
ATGACAATCTCAGGGAACTTCTTCTTTGGCTACTTTGCAACGTTCTTCTTTCTCCTTTTTCTGTCTCCAGCTCAGAGCTA
TGATTACGGGTCGGGTCTTGAGTCACTCGCTCGTGGGATGCTCGAATCAGCCAAGGACCCTGAGTTCTTCGAATGGATGA
GAGGGATAAGGAGGAGGATTCACGAGCACCCAGAGACTGGGTTTCAGGAGTTCAACACGAGTCAACTCGTTCGAGACGAG
CTTGACTCACTCGGAGTGATGTATAAGTGGCCTGTCGCGAAGACTGGCGTCGTGGCTTGGATCGGATCCGGTTCCAAACC
CGTTTTTGGACTTAGAGCCGACATGGACGCACTTCCGTTACAGGAATTAGTGGAATGGGAATCGAAGAGTAAAGTAGATG
GAAAGATGCATGCTTGTGGTCATGATACTCATGTTGCTATGCTTCTTGGAGCTGCTAAGCTTCTTCAAACCAGAAAACAC
CTCATCAAGGGGACTGTGAAACTTGTGTTTCAACCAGGAGAGGAAGGTTATGCAGGTGCTTATGAAATGCTAAAGGATGA
GATTCTAGACGACTTAGATGGGATTCTCAGTGTTCATGTCTTTCCATCGATCCCATCGGGTGGCATTGGCTCTAGGCCTG
GGACCGTTCTTGCAGGTGCGGGATTGTTTACAGTCACGGTTCATGGTCAAGGTAGTCACGCAGCTACACCGCACTTCTCT
AAAGACCCAGTTCTAGCAGCTTCTTCCGCTGTTGTCGCCTTGCAACAGATTGTTTCACGGGAAATGGATCCACTTGAAGC
TGGTGTGGTTACGGTTGGATACATTGAAGGAGGTCATGCTCAAAACGTAATACCGCAGAGTGCAAAATTTGGAGGCACTT
TCAGAAGCTTAAGCAACGATGGACTTCTATTTATTCAAAGACGGATCAAAGAGATTTCAGAGGCACAAGCATCTGTATAC
CGATGTAGAGCAGAAGTGAATTTCGAAGAGAAAAAGCCGTCGCTTCATCCGGTAATGATGAACGACAAAGGCCTATACGA
GCATGGTAAGAAAGTAGCAGAAGCCATGATTGGAGAAAGTAACTTCCATGATTTCCCGGTGACAATGGGAGGAGAGGATT
TCAGCTTCTTCACACAAAAGACGAAGGCTGCGATATTCGTGCTTGGGATAAAGAATGAGACGCTAGGCGCTGGTAAGCCG
CTTCATTCGCCTTACTTCTTTGTTGACGAAGAAGCTCTTCCGGTTGGGGCTGCTCTTCACGCAGCCATGGCCGTTTCTTA
TTTGGATAAACATGGTCATGTCCATAACGATGAGGTTAAGAGTGAATTATAA