Details for Capsella Locus Carubv10013704m

Position : scaf_3 ( 5`- 6094986 .. 6097709 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013704m

Protein [Map View]
MSVIRPSPIPIPRCRSQVLYRRLHSIQLIQRRRRRWNPRAEAEATAVESTARSPEAAGGKMVVELVGAFNEVTERMNSVW
LSTSSSRLLFKALKLSIPILQSLPLASDGRSPLSKALSLSILLADLQMDAEVISASILSEVVEANAISIYEVRDQIGTGT
AHLLHEIFRVKNIPFKVDVLDDETAASLRKFYLTYYDIRAVIMDLVSKLDEMRHLEHLPKYRQQTLSLEVLKIYSPLAHA
VGANHLSLELEDISFRYLFPCSYLYLDSWLRSHENGSKPLIDEYREQLHLSLKADFVLGEMVDDVYVKGRYKSRYSMMKK
LLRDGRKPEEVNDVLGLRVILMPKSVANDVELGEKACYRTSEIIRSLWKEIPHRTKDYIARPKENGYRSLHMAVDVSDSD
QRRPLMEIQIRTMDMDGSANAGTASHSLYKGGLTDPKEVNTCVLF*

DNA
ATGTCTGTAATTCGTCCTTCTCCGATTCCAATTCCGAGATGCAGATCTCAGGTACTGTATCGTCGTCTTCATTCTATTCA
ACTGATCCAGCGACGACGTCGACGGTGGAATCCGAGGGCTGAGGCGGAGGCTACTGCGGTTGAATCGACGGCTCGGTCTC
CGGAGGCAGCGGGAGGGAAAATGGTTGTGGAGCTTGTTGGAGCTTTCAACGAAGTGACGGAGAGGATGAATTCGGTTTGG
TTATCTACGTCTTCTTCTAGGTTGCTCTTTAAAGCTCTGAAGCTCTCGATTCCGATTTTACAGTCTCTTCCTCTTGCCTC
TGATGGTCGCTCTCCCCTTTCTAAGGCTCTCTCACTCTCTATCCTCCTCGCAGATCTCCAGATGGATGCAGAAGTTATCT
CGGCGAGCATTTTGAGTGAGGTGGTGGAGGCGAATGCGATATCCATATATGAAGTTAGAGACCAGATTGGTACCGGAACT
GCTCATCTGCTTCATGAGATTTTCCGTGTGAAGAACATCCCTTTTAAAGTTGATGTCTTGGACGATGAAACTGCTGCTTC
ATTGAGAAAGTTCTATCTAACCTACTATGATATCAGAGCTGTTATCATGGACCTTGTTTCAAAACTTGATGAGATGAGGC
ATTTGGAGCACTTGCCAAAGTACCGCCAGCAGACTCTCTCCCTTGAAGTCTTGAAGATTTATTCTCCTTTAGCTCATGCC
GTGGGGGCTAATCACCTGTCACTTGAGCTCGAGGACATCTCTTTCCGTTATCTTTTCCCGTGTTCGTATCTATACTTAGA
TTCATGGTTGAGAAGTCATGAGAATGGGTCTAAACCGTTGATTGATGAGTACAGAGAGCAGCTTCATCTGTCTTTGAAGG
CTGATTTTGTTTTGGGTGAAATGGTAGATGATGTATATGTCAAAGGTCGATATAAAAGCCGGTACAGCATGATGAAGAAG
CTTCTAAGAGATGGGCGTAAACCTGAAGAAGTTAATGATGTGCTTGGTCTACGAGTCATATTGATGCCAAAATCTGTAGC
AAACGATGTTGAACTTGGTGAAAAAGCCTGTTACCGAACAAGTGAGATTATCCGGTCTCTATGGAAGGAGATTCCACATA
GAACAAAAGACTACATTGCTCGGCCAAAGGAAAATGGGTATAGGAGTCTACACATGGCGGTTGATGTTAGCGACAGCGAT
CAGAGAAGACCTTTGATGGAGATACAAATACGGACAATGGATATGGATGGATCCGCTAATGCTGGAACAGCATCACATTC
TTTGTACAAAGGTGGTCTAACCGACCCAAAAGAGGTAAACACTTGTGTGCTTTTTTGA