Details for Capsella Locus Carubv10013694m

Position : scaf_3 ( 5`- 3330425 .. 3333324 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013694m

Protein [Map View]
MGRESVAVVSSPPSATAPSTAVSATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGEVDIYKHEPWDLAVFSRLKT
RDQEWYFFSALDKKYGNGARMNRATNKGYWKATGKDREIRRDIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRLVEYETE
NNGSLLDAYVLCRVFHKNNIGPPSGNRYAPFMEEEWADGGGALIPGVDVSVRVEPLPQANGNKHMDQEIHSASKNLININ
EPPRDGTPMDIEPNQQNHHESDIKPQEHNNHNAYDEDEETLKREHAEEDERPPPLCILNKEAPLPLLQYKRRRQNESNSS
SRNSQDHCSSTITTVDNTTTLNSSSAAATNTAISALLEFSLMGISEKKENQQLRPHKEASPSTPLVSPEEKVNDLQKEIH
QMSVERETFKLEMMSAEAMISILQSRIDALRQENEELKKKNANGQAI*

DNA
ATGGGTCGCGAATCTGTGGCTGTTGTGTCCTCGCCGCCATCGGCGACTGCGCCGAGTACTGCTGTGTCGGCGACCTCGCT
TGCTCCTGGCTTCCGATTTCATCCCACTGATGAGGAACTCGTGAGTTATTACTTGAAGCGGAAGGTTCTAGGCAAACCTG
TACGTTTCGATGCGATTGGGGAGGTCGACATCTACAAGCATGAGCCCTGGGATTTAGCAGTGTTTTCACGGTTGAAAACT
CGGGACCAAGAATGGTACTTCTTCAGCGCTTTAGATAAGAAGTATGGCAATGGTGCTAGAATGAACCGGGCAACTAACAA
AGGCTACTGGAAAGCAACTGGAAAAGACAGAGAAATCCGCCGGGATATTCAGTTGCTCGGTATGAAAAAGACGCTTGTTT
TCCACAGCGGGCGTGCTCCAGACGGTCTTCGGACTAATTGGGTCATGCACGAGTATCGCCTTGTGGAATATGAAACTGAA
AACAACGGAAGCCTGCTGGACGCATATGTGTTGTGCAGAGTGTTTCACAAGAATAACATTGGGCCACCAAGTGGGAACAG
ATATGCGCCATTCATGGAAGAGGAATGGGCTGATGGTGGAGGAGCTCTGATTCCAGGAGTAGACGTTAGTGTCAGGGTAG
AGCCGCTACCACAAGCCAATGGAAACAAACACATGGACCAGGAAATCCATTCAGCAAGCAAGAATCTCATTAACATCAAC
GAGCCACCAAGGGATGGCACTCCAATGGATATCGAACCTAACCAACAGAATCATCATGAGAGTGACATCAAGCCGCAGGA
GCATAACAACCATAATGCTTATGATGAAGATGAGGAAACACTGAAACGAGAGCACGCAGAAGAAGATGAGCGTCCTCCTC
CACTATGCATTCTTAACAAAGAAGCTCCACTACCTCTCCTCCAATACAAACGTAGACGCCAAAACGAGTCCAACAGCTCA
AGCAGGAACTCACAGGACCATTGTTCGTCCACAATAACAACCGTCGACAATACAACCACCTTAAACTCATCATCTGCTGC
CGCCACAAACACTGCCATATCAGCATTGCTTGAGTTCTCGCTTATGGGCATCTCAGAAAAGAAAGAAAACCAACAGCTGC
GTCCTCACAAGGAAGCTTCTCCCTCTACTCCACTAGTATCTCCTGAAGAGAAGGTTAATGATCTCCAGAAGGAGATTCAC
CAGATGTCTGTTGAGAGAGAAACTTTTAAGCTTGAGATGATGAGTGCAGAGGCTATGATCAGTATTCTCCAGTCAAGGAT
CGATGCACTGCGTCAGGAAAACGAGGAACTTAAGAAGAAAAACGCCAACGGACAAGCTATTTAA