Details for Capsella Locus Carubv10013680m

Position : scaf_3 ( 5`- 382456 .. 383968 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013680m

Protein [Map View]
MGRAHVVVIPYPAQGHVLPLLSFSGYLAKQGILTTFVNTEFNHNCIINSLSNSSHVADGINLVSVSDGLEDSPEERNIPG
KLSESVLRFMPTKVEELIERMIAGGTIISCVVADQSLGWAIGVAVKFGIRRATFCPAAAASMVLGFSIQKLIDDGLIDTD
GTSSVNKTIQLSPGMPMMETDKFVWVCLKNRESQRNIFQLMLQNNETVELTDWFLCNSVYELETAAFGLYPHILPVGPIG
LAHCFQEDSISTSLGSFLSQDRDCLDWLDRQIRGSVIYVAFGSYGVISNNQVDELATGLELTQRPVLWVTGPGGQQPIKL
WSDRVKVVRWAPQREVLSCGAIGCFVSHCGWNSTLEGAQNGIPFLCIPYFADQFINKAYICDVWKTGLGFERDGRGEVLR
LEVKKKIDEIMREDGEYKKRATIMKEIVMKSVAKDGVSYENLDKFVNWIKSQVK*

DNA
ATGGGAAGGGCACATGTTGTGGTCATACCGTATCCAGCACAAGGTCATGTTCTTCCTCTATTGAGTTTCTCAGGTTACCT
TGCAAAACAAGGAATCCTAACTACATTCGTAAACACCGAGTTTAACCACAATTGCATCATCAATTCCTTATCCAATTCAT
CTCATGTTGCGGATGGCATCAATCTTGTTTCGGTCTCCGACGGTTTAGAAGATTCACCGGAAGAGAGGAACATTCCAGGG
AAGTTGTCTGAATCGGTTTTGCGTTTTATGCCTACCAAAGTGGAGGAACTGATCGAGAGGATGATCGCCGGTGGTACGAT
CATAAGCTGTGTTGTAGCGGATCAGAGCTTGGGATGGGCCATCGGAGTTGCGGTTAAGTTTGGGATCAGACGTGCCACTT
TTTGTCCCGCCGCGGCTGCGTCTATGGTTCTTGGATTTAGTATTCAAAAACTAATCGATGATGGTCTCATAGATACTGAT
GGGACTTCGAGTGTAAATAAGACAATTCAACTATCTCCTGGGATGCCGATGATGGAAACAGACAAGTTTGTGTGGGTTTG
TCTGAAGAACAGAGAATCTCAAAGGAACATATTCCAACTTATGCTTCAAAACAATGAGACAGTTGAGTTAACGGATTGGT
TTCTGTGTAACTCCGTGTATGAACTCGAAACGGCAGCGTTTGGATTGTACCCACATATATTACCAGTTGGTCCCATTGGG
TTGGCTCATTGTTTTCAAGAGGATTCCATTTCCACGTCATTAGGAAGCTTTTTATCTCAGGACCGGGATTGTCTGGATTG
GCTGGACCGGCAGATTCGAGGTTCGGTGATATATGTTGCCTTTGGGAGTTATGGAGTTATCAGCAACAATCAAGTAGATG
AGCTAGCAACTGGCCTAGAGCTTACCCAGAGGCCAGTCTTGTGGGTCACCGGTCCCGGTGGTCAACAACCAATCAAACTC
TGGTCCGATCGTGTCAAAGTGGTGAGATGGGCACCACAACGGGAGGTCCTTTCCTGTGGAGCCATTGGATGTTTCGTGAG
TCATTGTGGGTGGAATTCAACTTTGGAAGGAGCCCAAAATGGCATACCTTTCTTATGCATACCTTATTTCGCAGACCAAT
TTATCAACAAAGCATACATATGCGATGTATGGAAGACTGGATTAGGATTTGAAAGAGATGGACGAGGAGAGGTTCTGAGG
TTAGAGGTGAAGAAGAAGATCGATGAGATCATGAGAGAGGATGGAGAGTATAAAAAACGAGCTACGATCATGAAAGAGAT
TGTGATGAAAAGTGTTGCAAAAGATGGAGTTTCTTATGAGAATCTTGATAAATTTGTCAACTGGATCAAATCACAAGTGA
AGTGA