Details for Capsella Locus Carubv10013672m

Position : scaf_3 ( 5`- 2571082 .. 2573056 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013672m

Protein [Map View]
MVPPVIYTYARRRSRRLGSDDDSSVMMTPRRPDSDIIEVCDENRSISLFEDGEDYDDRIRVLGCIAETETRHGSSNLLLQ
CHDDVCCLDKEKSDSFVSSSRRNLDDFLSGCSYKGVRTRKRDAFGSETKSNLVSPQIDVDDVVSESHAGVRRVSPYFQGS
TVSQQSKEGCDSHSVSSQSGRNCRKRCSRVQAKVPRVSPYFQASAISQCDSDIVSSQSGGSYRRDSSKHQAKVRRVSRYF
QASADSEQPNPPRDLRKYFKVVKVSRYFHDVSADGIQVADSQKEKSRRVRKTPVVSPSLSPSQKTDEAYLRKTPDNTWVP
PRSPCNLLQEDHWHDPWRVLVICMLLNKTSGAQTRGVISDLFTLCPDAKTATEVEEKEIESLIKPLGLQKKRAKMIQRFS
LEYLNESWTHVTQLHGIGKYAADAYAIFCNGNWDRVKPSDHMLNYYWEFLRIRYKL*

DNA
ATGGTTCCTCCTGTAATTTATACGTATGCGCGAAGGAGAAGTCGGAGACTTGGGAGCGACGATGATAGTTCAGTGATGAT
GACTCCTCGGAGACCCGACTCCGATATTATTGAGGTATGTGATGAGAATCGCTCGATTAGTTTATTTGAGGATGGGGAGG
ACTATGATGATCGAATTCGAGTTTTGGGTTGCATTGCTGAGACTGAAACTCGACATGGTTCAAGTAATTTGCTTCTTCAA
TGTCATGATGATGTTTGTTGCCTCGACAAGGAGAAGAGCGATAGCTTTGTTTCATCTAGTAGAAGAAATTTGGATGATTT
TTTATCTGGGTGCTCTTATAAGGGTGTGAGGACTAGGAAAAGAGATGCATTTGGAAGTGAAACAAAGAGTAATCTTGTTT
CTCCTCAAATTGATGTTGATGATGTTGTTTCTGAATCTCATGCTGGTGTAAGAAGAGTTTCTCCATACTTCCAGGGGTCT
ACTGTGTCACAACAGTCCAAAGAAGGGTGTGATTCTCATAGTGTTTCCTCTCAAAGTGGAAGAAATTGTAGGAAAAGATG
CAGCAGAGTTCAAGCTAAAGTCCCTAGAGTTTCTCCATACTTCCAGGCATCTGCTATTTCACAGTGTGATTCTGACATTG
TTTCTTCTCAAAGTGGAGGAAGTTATAGGAGAGATAGCAGCAAACATCAAGCTAAGGTCAGAAGAGTTTCCCGTTATTTC
CAGGCGTCAGCTGATTCAGAACAGCCAAACCCGCCAAGGGATTTGCGCAAGTATTTTAAAGTTGTGAAAGTTTCAAGATA
TTTCCATGATGTGTCTGCGGATGGAATTCAAGTTGCTGATTCACAAAAGGAGAAATCTAGGAGGGTGAGGAAAACTCCCG
TTGTGAGCCCTTCACTATCGCCTTCTCAGAAGACGGATGAGGCATACCTGCGCAAAACGCCAGATAACACATGGGTGCCT
CCACGCTCTCCGTGTAATTTACTTCAAGAAGATCATTGGCATGATCCATGGCGGGTGCTAGTTATATGTATGCTTCTCAA
CAAAACATCTGGTGCACAGACGCGGGGAGTGATATCAGACTTGTTCACATTGTGTCCTGATGCAAAGACTGCAACAGAAG
TTGAAGAAAAGGAGATAGAGAGTCTAATAAAACCTCTCGGACTACAAAAGAAGAGAGCCAAAATGATTCAACGGTTTTCT
CTCGAGTATCTTAATGAGAGCTGGACTCATGTCACTCAACTGCATGGCATTGGAAAGTATGCAGCGGATGCGTATGCGAT
ATTCTGTAACGGGAACTGGGATCGCGTGAAGCCTAGTGACCATATGCTAAACTATTACTGGGAATTCCTCAGGATCCGGT
ATAAACTATGA