Details for Capsella Locus Carubv10013669m

Position : scaf_3 ( 5`- 2048047 .. 2050051 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013669m

Protein [Map View]
MASDRFWRGGDRVEVERLVSGATAYFTATVVSAPSVRKKHVWVEHEALTVGGSARMKEYVIPSLLRPSPPRELNRRFKAN
DEVDVFRDTEGCWVRGTVTTVLGDSRYIVAFKGENRPEIEFDQLDMRLHREWQGGSWVPSLFQQSNVLESTPKSIKLKIK
IKRRDQYEKGALVEVRSEEAAYKGSWYCALILCLLGDDKYIVEHLNFSRDGGESIPLRDVVESQNMRPVPPPQVSPVECY
EPGDEVDVWFNKRWWTGRVSKVLGGGSKYSVFITSKGEEPTILSSNLRPHKDWINGEWSNPSKAECYRPPLKKLKSCERA
EKVFNNEMMVEVRSDERGYEGSWFSAKIISYLGDNRYTVEYQTLKTDDEGELLKEEARGSDIRPIPPPLIPKAYRYKLYE
DVDAWYNEGWWSGRVYTINYNYTRYGVYFKTNDERLEFAYSDLRPCQVWRNGKWSHA*

DNA
ATGGCGAGCGATCGATTTTGGCGGGGCGGCGACCGAGTTGAGGTGGAACGACTCGTTTCCGGCGCGACGGCGTACTTTAC
GGCTACTGTTGTTAGCGCGCCTTCGGTGAGAAAGAAGCACGTTTGGGTGGAACACGAAGCCCTAACTGTTGGAGGTTCGG
CACGTATGAAGGAGTACGTTATTCCCTCCCTCCTTCGCCCATCTCCGCCGCGTGAGCTCAACCGACGGTTCAAAGCTAAC
GATGAGGTCGACGTCTTCAGAGACACCGAAGGTTGCTGGGTTAGAGGCACTGTTACGACCGTACTTGGAGATTCAAGGTA
CATTGTGGCGTTTAAAGGGGAAAATCGTCCAGAAATAGAGTTTGATCAGCTCGATATGAGGCTGCATCGTGAATGGCAAG
GTGGTTCGTGGGTTCCCTCTCTTTTTCAACAGAGCAATGTCTTGGAATCGACACCTAAAAGTATTAAACTGAAGATAAAA
ATCAAGAGAAGAGATCAATATGAGAAGGGAGCTCTTGTGGAAGTCAGAAGTGAAGAAGCAGCTTACAAGGGTTCTTGGTA
TTGTGCACTTATACTTTGTTTATTAGGTGACGATAAGTACATTGTTGAACACCTGAACTTTAGTAGAGATGGTGGTGAGT
CGATCCCTCTGAGAGATGTTGTAGAATCCCAGAACATGAGACCAGTTCCCCCTCCACAAGTTTCGCCTGTTGAGTGCTAT
GAACCAGGGGATGAAGTTGATGTTTGGTTCAACAAAAGGTGGTGGACCGGTCGTGTTTCCAAAGTTCTCGGAGGAGGTTC
CAAGTATTCAGTTTTTATCACCTCAAAAGGTGAAGAACCGACAATCCTAAGTTCCAACTTAAGGCCGCACAAAGATTGGA
TCAATGGAGAATGGAGTAATCCTTCCAAGGCAGAATGTTACAGACCTCCACTTAAGAAGCTAAAATCTTGTGAGAGAGCA
GAGAAGGTCTTCAACAATGAAATGATGGTGGAAGTTAGAAGCGATGAACGAGGTTACGAAGGATCATGGTTCTCTGCGAA
GATCATAAGTTACTTAGGGGACAACAGATACACAGTGGAGTATCAAACACTAAAAACAGATGATGAAGGAGAGTTGTTGA
AGGAAGAAGCAAGAGGTTCAGATATAAGACCTATTCCTCCTCCACTGATTCCAAAGGCATACAGATATAAATTGTATGAA
GATGTGGATGCTTGGTACAATGAAGGTTGGTGGTCTGGCCGAGTCTATACGATAAATTACAACTACACGAGATATGGTGT
CTACTTCAAGACGAATGATGAGAGATTGGAGTTTGCTTACAGTGATCTAAGGCCTTGCCAAGTGTGGAGAAACGGAAAAT
GGAGTCATGCTTAA