Details for Capsella Locus Carubv10013666m

Position : scaf_3 ( 5`- 8387579 .. 8390364 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013666m

Protein [Map View]
MQKRELGKSGGNSGGSSGPPAKRGRPFGSTSANSAAAAAAAAAAEAMSPSALLGPSLLVHNSFMEQNNRRIVLALQSGLK
SEVTWALNTLTLLSFKEKEDIRRDFTPLAKISGLLDALLLIIDDWRDIALPKDLTRGTRVRTLGTNTSVTGFGNEYDALA
SIQPPGSGIGSSAAEVLGKKKHQSSQWWMEEDGLFNLDDEGRSEKQMCAIAASNVIRNFSFMPDNEVVMAQHRHCLETVF
QCIQDHMTEDEELVTNSLETIVNLAHLMDLRIFSSLKQSYININEKKAVQAVVGILDSSVKAWNCAAAELLGRLIINPDN
EPFISPLIPQIHKRLVDLLSIQAVDAQAAAVGALYNLVEVNMDCRLKLASERWAVDRLLKVIKTPHPVPEVCRKAAMILE
NLVSEPQNRGLLLAYENAFAELLFQDGKYSDSFARILYELTARSNSRVASARGIWGM*

DNA
ATGCAGAAACGGGAGCTTGGGAAATCCGGCGGTAATTCCGGTGGATCTTCGGGACCACCGGCGAAGAGAGGTCGTCCATT
CGGTAGTACAAGTGCTAACTCAGCTGCTGCTGCAGCTGCAGCTGCGGCGGCCGAAGCGATGTCTCCGTCAGCTCTACTCG
GTCCTTCTCTGCTTGTTCACAATTCCTTCATGGAACAGAACAACAGAAGAATAGTCCTTGCACTACAGAGTGGTTTGAAG
AGTGAGGTGACATGGGCTTTGAATACGCTTACATTGCTCTCCTTCAAGGAAAAGGAGGATATTCGAAGAGATTTCACGCC
TCTAGCAAAGATATCTGGCTTGCTTGATGCCCTTCTCTTAATTATAGATGACTGGCGTGATATAGCTCTCCCAAAGGACC
TAACAAGAGGAACTAGGGTCAGAACTCTAGGTACAAATACTTCAGTTACGGGATTTGGCAATGAGTATGATGCTCTAGCC
TCTATTCAACCCCCTGGATCTGGAATTGGTTCTTCAGCTGCTGAAGTATTAGGGAAAAAAAAACATCAGTCATCTCAGTG
GTGGATGGAAGAGGATGGTTTATTTAATCTAGACGATGAAGGGAGATCAGAGAAACAAATGTGCGCCATTGCTGCATCAA
ACGTTATCCGCAACTTCTCCTTCATGCCAGATAATGAAGTTGTAATGGCCCAGCATCGCCATTGCTTAGAAACTGTTTTT
CAGTGCATACAAGATCACATGACCGAGGACGAAGAGCTAGTCACAAACTCGCTCGAGACAATTGTAAACCTAGCGCATCT
GATGGATCTGCGAATCTTCAGCTCGCTTAAACAGTCATACATCAACATAAATGAAAAGAAAGCTGTTCAAGCTGTGGTCG
GAATTCTTGATTCATCCGTCAAGGCTTGGAATTGTGCTGCAGCTGAGTTGTTGGGGCGTTTGATAATCAATCCCGACAAT
GAACCTTTCATTAGTCCACTAATCCCACAGATACACAAGAGACTGGTCGATCTTTTGAGCATACAAGCCGTTGATGCACA
AGCCGCAGCTGTTGGAGCACTCTACAATCTTGTGGAGGTTAACATGGACTGCAGATTAAAGCTCGCTAGTGAGAGATGGG
CGGTTGATAGATTGCTGAAAGTGATAAAGACTCCGCATCCGGTTCCAGAAGTTTGCAGAAAAGCTGCAATGATACTCGAG
AACCTCGTCTCTGAGCCTCAGAACAGAGGATTGCTACTCGCATACGAGAATGCTTTCGCCGAGCTGCTTTTCCAAGATGG
TAAGTATTCTGATTCGTTTGCTAGGATCTTGTATGAACTCACTGCTAGATCTAATAGCAGAGTTGCTTCAGCTAGAGGAA
TCTGGGGTATGTAA