Details for Capsella Locus Carubv10013659m

Position : scaf_3 ( 5`- 6856858 .. 6858675 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013659m

Protein [Map View]
MAPNYNMLSFFLILSLYITSMLATGNNHITDRKALEIIIGGSNDNSPAPSPEPEDCPPPSPPSQTPSPPPPEALPPPPPP
PLKFSSPLIKKVYPVIKNFQMLIEDDPKKILKTWVGTDICAKDKYIGLECAKFPGTNHLALASIQFNNFNLGGKKLRLDN
FLNKLDEVTIFHANSNNFVGSVPKVSNLKYLFELDLSNNKLSGEFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDV
LFINDNNLVQSLPENLGSITALYLTFANNRFTGPIPGSIGDIKSLQEVLFLNNKLTGCLPYQIGNLNRATVFDVESNELT
GPIPYSFGCLNKMEQLNLARNKFYGTIPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKKKILDVGMNCILDLANQRTPW
ECTKFFLRKQKCPNFKTFFYIPCGKDPHRIKPDQEGLDGQASPPLSYGALNPDRIRNL*

DNA
ATGGCTCCAAATTATAATATGCTTTCCTTTTTCTTGATTCTGTCTCTTTACATTACTTCAATGCTAGCCACCGGAAACAA
CCACATCACCGACAGAAAAGCTCTTGAAATCATCATTGGCGGCTCCAACGACAACTCTCCGGCGCCATCTCCAGAGCCAG
AAGACTGTCCCCCGCCGTCTCCACCTTCTCAAACACCATCACCGCCGCCACCAGAGGCACTTCCTCCTCCACCGCCACCG
CCGCTAAAATTCTCGAGCCCACTAATAAAGAAAGTGTATCCAGTCATCAAGAATTTCCAGATGCTAATCGAAGACGATCC
AAAGAAGATACTCAAAACATGGGTAGGCACCGACATTTGCGCCAAGGACAAATACATAGGACTTGAGTGCGCCAAGTTCC
CGGGAACAAACCACCTCGCACTTGCGAGTATTCAGTTCAACAATTTTAACTTGGGTGGCAAGAAACTCCGGCTAGATAAC
TTCCTCAATAAGTTAGATGAAGTCACCATCTTCCACGCAAACAGTAACAATTTCGTGGGATCTGTTCCCAAAGTCAGCAA
CCTCAAGTACCTTTTCGAGCTTGATCTCAGCAACAATAAGCTCTCTGGAGAGTTCCCGAGCTCTGTGTTAAAAGCAACGA
ACCTTACGTTTCTTGATCTCAGATTCAATTCTTTCTCCGGTTCTGTGCCTCCTCAGGTGTTTAATCTCGATCTCGACGTT
TTGTTCATCAACGACAACAATCTTGTTCAGAGTCTCCCTGAGAATCTCGGATCCATCACCGCTCTTTACCTCACATTCGC
TAACAACAGATTCACGGGTCCTATTCCGGGAAGCATTGGTGACATCAAGTCCTTACAAGAAGTCCTTTTCTTGAATAACA
AGTTAACCGGTTGCTTACCATACCAAATTGGGAACCTTAACCGAGCTACGGTTTTTGATGTCGAGTCTAACGAGCTAACT
GGTCCGATTCCTTACTCTTTCGGATGCCTAAACAAGATGGAGCAGCTCAATTTGGCTAGGAACAAGTTCTACGGTACCAT
ACCGGAGATCCTCTGCGAGCTCTCAAGCCTCAAGAACCTTTCTCTCTCGTCCAATTACTTTACGCAGGTCGGACCAAAAT
GTCGAACACTCATCAAGAAAAAGATTCTAGACGTGGGTATGAATTGTATTCTAGATCTTGCGAATCAAAGAACACCGTGG
GAATGCACCAAGTTTTTCTTGCGGAAACAGAAGTGTCCTAACTTCAAGACTTTCTTTTATATACCTTGTGGCAAAGATCC
TCACCGAATTAAACCAGATCAAGAAGGGTTAGACGGTCAGGCTTCCCCGCCGCTATCTTACGGTGCTCTTAACCCGGACC
GGATTCGGAATCTCTAG