Details for Capsella Locus Carubv10013653m

Position : scaf_3 ( 5`- 1886270 .. 1888336 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013653m

Protein [Map View]
MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPCVLIKKLAKSGKHAEIWGAPKGN
NNPNQSQMANQFKGMQIDNGKASGGGGGGGGNNNNNKKGQKGGGGGNSNAPKMGQQLNPQQMQQLQQLQKMKGFQDLKLP
PQLKGSASANKNQNQNQKGVKFDVPEDDDDDDDFSDEFDDEFTDDDDDDFDDEFDDLPLPSNKMKPNMMMPNAQQMMMNA
QKNANLGGGPAKNGGKGAPGGGGGGKGGPGGGGGNQNQGGGKNGGGKNGGGGGHPQDGKNGGGGGPHGGKKGNGGGGPMS
GGIPGGFRPMGGGGAPPNMSMPMGMGGPMGNIPAVQGLPASGPGGAPPGYFQGGGADPMQMQQQQYLAAVMNQQRAMGNE
RFQPMMYARPPPAVNYMPPNPHQYPNPHPYPYPYPYPQPYGNDQYSHAFSDENTSSCDIM*

DNA
ATGAGTAAAGAAGAGTTTATGAAGATCCAGACTTGTGTTCTTAAAGTGAACATTCACTGTGATGGCTGTAAGCAGAAAGT
CAAGAAAATCTTGCAGAAGATCGAAGGTGTTTTCACGACCAAGATTGACTCAGAGCAAGGGAAAGTGACTGTCTCAGGGA
GTGTAGATCCTTGTGTTCTCATCAAGAAGCTGGCCAAATCTGGTAAACATGCTGAAATCTGGGGAGCTCCTAAGGGTAAC
AACAATCCCAATCAGTCCCAAATGGCGAATCAGTTTAAGGGGATGCAGATTGACAATGGAAAAGCAAGCGGCGGCGGTGG
TGGCGGCGGCGGAAACAACAATAACAACAAGAAAGGTCAGAAGGGCGGCGGAGGAGGTAACAGTAATGCACCAAAGATGG
GTCAGCAACTGAATCCTCAACAGATGCAGCAGCTTCAACAGCTTCAGAAGATGAAAGGGTTTCAAGATCTGAAGCTTCCT
CCTCAGTTAAAAGGCTCTGCTTCAGCGAACAAGAACCAAAACCAGAACCAGAAAGGAGTCAAGTTCGATGTTCCTGAGGA
TGATGATGATGATGATGATTTTAGTGACGAGTTCGACGATGAGTTTACTGATGATGATGACGACGACTTTGATGATGAGT
TCGATGATCTCCCTCTTCCCTCTAATAAGATGAAGCCTAATATGATGATGCCTAATGCTCAACAGATGATGATGAACGCT
CAAAAGAACGCTAATCTTGGCGGTGGTCCCGCTAAAAACGGCGGTAAAGGCGCTCCCGGCGGCGGTGGTGGTGGCAAGGG
TGGTCCTGGTGGCGGCGGTGGAAATCAAAACCAAGGCGGCGGCAAAAACGGCGGCGGTAAAAACGGTGGTGGTGGTGGAC
ATCCGCAAGACGGTAAAAACGGTGGCGGAGGTGGTCCACACGGCGGAAAGAAAGGTAACGGCGGAGGTGGGCCTATGTCT
GGAGGGATTCCGGGCGGTTTCCGACCCATGGGAGGCGGAGGAGCACCACCGAACATGAGCATGCCTATGGGTATGGGTGG
TCCGATGGGAAATATTCCGGCGGTTCAGGGATTACCAGCGAGTGGTCCGGGCGGTGCACCGCCGGGTTATTTCCAAGGGG
GCGGGGCAGATCCGATGCAAATGCAGCAACAGCAATATTTAGCAGCTGTAATGAACCAGCAAAGAGCTATGGGGAACGAG
CGGTTCCAACCAATGATGTACGCACGTCCACCACCGGCGGTTAACTATATGCCGCCAAACCCGCACCAATATCCGAATCC
GCATCCGTACCCGTACCCGTATCCATACCCACAACCTTACGGGAATGATCAATACTCTCATGCCTTTAGCGACGAGAACA
CATCAAGCTGCGATATAATGTGA