Details for Capsella Locus Carubv10013643m

Position : scaf_3 ( 5`- 7334428 .. 7337531 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013643m

Protein [Map View]
MDSIEPPSFSLGFDLDAASDPQSDSHQNPSPSGDQLIGDEPEPGLTVPDSDQELDPAYVSPVLKRLRRGINPNKCPAKDD
RGVASDLLGCREDRDDDIEEFSSPEDSSHTDAPASTRSHFSSCSSRVPLHGTGVLSNQPSISRGKRKQSDVPASAGSGIS
SIASLFQRSARSPLRRFQLLDSDSEDDHPSTSRDLSGVTKATNSSSKDNLSVASKSKRKEPGSIPCIKDLWKDFSPAISK
IQTPALDDVCQDYFSSIKTTSTAQKQSSAVASSSNSGYHNLTGFQQTGQFLDLSHPSPPSHRFFLHSDPRIRNLARQRLP
NFLPLGIVNDRESQREVFLVDYMNQFGSKGSSKTEASSSKSCRRGQAKSKVSKGQESTHTSEGWLNPKTRSAAPKDAGKR
RVSANSGSAGHWFTSAEGRKVYISKSGQEFSGQSAYRCYKKETGGGGGFKKSKKKRQPKKKARS*

DNA
ATGGATTCAATTGAGCCGCCGTCGTTTTCGCTAGGGTTTGATCTTGATGCTGCATCGGATCCCCAATCTGATTCCCATCA
GAACCCTAGCCCCTCCGGCGACCAGTTAATTGGGGACGAGCCTGAGCCGGGACTTACGGTCCCAGATTCTGATCAGGAGC
TTGATCCAGCTTATGTAAGCCCTGTTCTCAAGCGGTTGCGACGGGGGATTAATCCAAACAAGTGTCCTGCTAAAGATGAT
AGGGGCGTGGCCAGTGACTTGTTAGGTTGCAGGGAGGATCGGGATGATGACATCGAGGAGTTCTCTTCTCCAGAGGATTC
TTCTCACACGGACGCACCTGCCTCAACAAGGAGTCATTTTTCTAGTTGCAGCTCAAGGGTGCCACTCCATGGTACAGGAG
TCTTGTCTAATCAGCCTTCTATCTCTCGGGGGAAAAGAAAGCAGTCGGATGTTCCAGCATCTGCTGGCTCTGGGATTAGT
TCTATTGCATCGTTGTTCCAGAGGTCAGCTCGTAGTCCTCTGCGAAGGTTCCAGCTACTAGATTCAGATTCTGAAGATGA
CCATCCATCCACCAGCAGAGATTTAAGCGGCGTAACTAAAGCAACTAATTCATCCTCAAAGGATAACCTATCTGTCGCTA
GTAAATCAAAGAGAAAGGAACCTGGATCTATCCCCTGTATTAAAGATCTGTGGAAAGATTTTTCGCCGGCAATTTCCAAG
ATTCAAACACCAGCTTTGGATGATGTTTGTCAGGACTATTTTAGCTCCATCAAGACGACTAGCACAGCTCAGAAACAAAG
CAGCGCAGTGGCAAGTAGTAGCAATAGTGGATATCATAACTTGACTGGTTTTCAGCAAACTGGGCAATTCTTGGATTTAT
CCCACCCTTCTCCTCCATCTCATCGTTTCTTCTTGCATAGTGATCCAAGGATCCGGAATCTTGCTCGACAGCGGTTACCA
AACTTCTTGCCCCTGGGAATAGTCAATGATAGGGAGAGCCAGCGAGAGGTGTTCCTTGTTGATTATATGAATCAATTTGG
CAGCAAAGGAAGTTCGAAAACTGAAGCCTCTAGCAGCAAAAGCTGCAGAAGAGGGCAAGCAAAGTCAAAGGTTTCAAAGG
GCCAAGAGAGCACACACACTTCTGAAGGCTGGTTAAATCCTAAAACGAGATCTGCAGCTCCAAAGGATGCTGGGAAAAGG
CGTGTATCAGCTAACAGTGGCTCTGCAGGTCATTGGTTCACATCCGCAGAAGGAAGGAAGGTTTATATCTCTAAATCCGG
ACAGGAGTTTTCAGGTCAAAGTGCATATAGATGTTACAAAAAGGAGACCGGAGGCGGAGGCGGGTTTAAGAAGTCGAAAA
AGAAACGACAGCCAAAGAAGAAGGCGAGGAGTTGA