Details for Capsella Locus Carubv10013642m

Position : scaf_3 ( 5`- 5378364 .. 5381741 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013642m

Protein [Map View]
MASPLSSSTIGSHRILFLHPSPLNRRSLFVKPKLPFNRTNSGDFRMRLHSTSSKIGTKELIHSHKSSIESKLNPFEAGTK
NLEKLVATMLIFVQVWSPMPLLGLDSAYISPAEAVLYSPDTKVPRTGELALRRAIPANPSMKTIQASLEDISYLLRIPQR
KPYGTMESNVKKALKVAIDDKDAILANIPADLKDKGSELYATLIDGKGGLQSLITNIKKQDPDKVSLGLAASLDTVAELE
LLQASGLSFLLPQQYLNYPRLAGRGIVEITIEKGDGSTFSAESGGDQRKSATIQIVIDGYSAPLTAGNFAKLVTSGAYDG
VKLNTVNQAVITEDGSAKVESVSVPLEVMPSGQFEPLYRTPLSVQDGELPVLPLSVYGAVAMAHSENSDEYSSPYQFFFY
LYDKRNSGLGGLSFDEGQFSVFGYTTSGRDILGQIKTGDVIKSAKLIEGQDRLILPALNNNSST*

DNA
ATGGCTTCTCCTTTGTCTTCTTCCACCATCGGCTCTCACCGGATTTTATTTCTCCACCCTTCACCTCTCAATCGCAGATC
ACTCTTCGTAAAACCCAAATTACCCTTTAATCGAACCAATTCCGGAGATTTCCGCATGCGTTTGCATTCTACATCCAGTA
AGATTGGCACTAAGGAACTTATACATTCTCACAAATCTTCAATTGAATCAAAGTTGAACCCTTTTGAAGCTGGGACTAAG
AATCTCGAGAAATTGGTTGCAACGATGCTGATATTTGTTCAAGTTTGGTCTCCAATGCCCTTGCTTGGTCTAGACTCTGC
TTACATTTCACCTGCAGAGGCTGTTCTTTACTCTCCCGACACGAAAGTTCCAAGAACTGGGGAGCTTGCTCTCAGAAGAG
CTATTCCTGCTAATCCAAGCATGAAGACAATACAGGCTTCATTGGAAGATATATCATATCTTCTAAGGATTCCGCAAAGA
AAGCCTTATGGTACCATGGAGAGCAATGTCAAAAAAGCTCTGAAGGTGGCTATAGACGATAAGGATGCGATATTGGCTAA
TATACCAGCTGACTTGAAAGACAAGGGCTCAGAACTGTATGCAACCCTGATTGACGGCAAGGGTGGACTTCAGTCACTTA
TAACAAATATTAAGAAACAAGATCCTGATAAAGTGTCCCTTGGCCTGGCAGCATCACTAGACACAGTTGCAGAACTGGAG
TTATTGCAGGCATCAGGATTGTCATTTTTACTTCCTCAGCAGTACTTAAACTATCCAAGGTTAGCAGGTAGAGGAATTGT
GGAAATCACAATTGAGAAAGGTGATGGTTCAACATTTTCAGCTGAATCTGGGGGTGATCAAAGAAAGAGTGCTACAATCC
AGATCGTTATAGATGGATATTCAGCACCCCTAACAGCAGGGAATTTCGCAAAACTGGTAACTAGCGGTGCATATGATGGA
GTCAAACTCAATACAGTGAACCAAGCTGTTATCACAGAGGATGGGAGTGCTAAGGTGGAGAGTGTTAGTGTGCCATTGGA
AGTAATGCCTTCTGGACAGTTTGAGCCACTCTACAGAACCCCATTGAGTGTTCAGGATGGGGAGTTACCAGTTCTTCCTT
TATCGGTTTATGGAGCTGTTGCAATGGCGCACAGCGAAAACTCAGATGAATACTCTTCTCCTTACCAATTCTTTTTCTAC
CTATACGACAAAAGAAACTCTGGCTTAGGAGGTTTATCCTTTGATGAAGGGCAGTTCTCAGTCTTCGGATACACAACATC
AGGAAGAGATATTCTTGGGCAGATCAAGACAGGAGATGTAATCAAATCTGCAAAACTAATCGAAGGCCAAGATCGCCTCA
TTTTGCCTGCTCTAAACAACAACTCATCCACTTGA