Details for Capsella Locus Carubv10013629m

Position : scaf_3 ( 5`- 9583617 .. 9586292 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013629m

Protein [Map View]
TCLSCLNLKQISLLLFLYYHFLLLLQLQSSPFQNPITHKLHGAISRWRLLTLSFSVTSHHKNQTFIIKKMTLIASLSLPP
PAIIQRRTLSDSNRFKCQFRSSCSPLSSLHSSSLSKFLDFSLRRRHGGGLVPVVACSTTPFMGRVGLHWRDGNMSLLSFC
GGTDVTERADSSQFWVSKELYAPALGGIMLSIGIQLSVDDFALAFKRPVPLSVGFVAQYVLKPLLGVLVANAFGMPRTFY
AGFVLTCCVAGAQLSSYASSLSKADVAMSILLTSSTTIASVLFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLV
LNTYAKPVVTLIQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIVPIVTFHAVAFVLGYWFSKIPGLRQEEEVSRT
ISLCTGMQSSTLAGLLASQFLGSSQAVPAACSVVVMAIMGLCLASFWGSGFRIRDILSLSTPQATAES*

DNA
ACTTGTCTATCATGCCTAAACCTTAAACAAATCTCTCTTCTTCTTTTTCTATATTATCACTTCCTTCTTCTTCTTCAACT
CCAATCCTCACCCTTTCAAAATCCCATTACGCACAAACTCCACGGCGCCATTTCACGGTGGCGCTTATTAACCCTCTCCT
TCTCCGTCACCTCTCATCATAAAAATCAAACCTTTATTATAAAAAAAATGACTTTGATCGCTTCTTTGTCCCTCCCACCA
CCAGCTATTATACAAAGACGAACACTTTCGGATTCTAATCGCTTCAAATGTCAATTTCGCTCTTCTTGTTCGCCTCTGTC
TTCTCTTCATTCTTCATCTCTTAGTAAATTTCTAGATTTTAGTCTACGGCGGAGACACGGCGGCGGATTGGTGCCGGTGG
TGGCGTGTTCAACGACGCCGTTTATGGGTAGAGTTGGATTGCATTGGAGAGATGGGAACATGTCTCTGTTATCGTTTTGT
GGTGGGACTGATGTTACTGAGAGAGCTGATTCGTCTCAGTTTTGGGTATCTAAAGAACTGTATGCTCCTGCTCTTGGAGG
GATTATGTTGTCTATTGGAATCCAGCTTTCAGTTGATGATTTTGCTCTTGCATTCAAAAGACCTGTGCCGTTATCTGTTG
GGTTTGTTGCTCAGTATGTTCTGAAACCGCTGCTTGGGGTTTTAGTTGCTAATGCTTTTGGGATGCCGAGGACCTTCTAT
GCTGGCTTTGTACTCACATGTTGTGTGGCAGGGGCTCAATTGTCTAGTTACGCCAGTTCTCTGAGCAAAGCAGATGTGGC
CATGAGCATTCTTCTCACTAGTTCGACAACTATTGCCTCTGTACTTTTTACCCCTTTGCTAAGTGGTCTTCTTATTGGAT
CGGTAGTTCCTGTTGATGCAGTTGCCATGTCCAAGTCCATACTACAGGTGGTGCTTGTTCCAGTCACCCTTGGCCTTGTG
TTAAATACTTATGCAAAGCCTGTGGTCACTCTTATTCAACCCGTGATGCCGTTTGTTGCTATGGTATGCACTTCATTGTG
CATTGGAAGCCCACTTTCAATAAATCGCAGTCAGATTCTGTCAGCTGAAGGTCTTGGATTGATTGTTCCCATTGTTACAT
TCCATGCAGTAGCATTTGTCTTGGGATATTGGTTCTCTAAGATCCCAGGCTTACGACAAGAGGAAGAAGTTAGCCGGACT
ATCTCCCTCTGCACAGGGATGCAGAGCTCCACATTAGCCGGGCTTCTTGCAAGTCAGTTCCTTGGTAGCAGCCAAGCCGT
TCCAGCAGCTTGCTCTGTGGTTGTAATGGCCATAATGGGTCTATGCCTTGCCTCTTTCTGGGGCAGTGGGTTTCGAATCA
GGGACATTCTGTCGCTATCAACACCGCAAGCCACTGCTGAATCATGA