Details for Capsella Locus Carubv10013628m

Position : scaf_3 ( 5`- 685965 .. 689177 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013628m

Protein [Map View]
MGSSCESVPTANSSTAVVGSIPPFLSKTYDMVDDPLTDDVVSWSSGNNSFVVWNVPEFAKQFLPKYFKHNNFSSFVRQLN
TYGFRKVDPDRWEFANEGFLRGQKQILKSIVRRKPAQVQPQQQPQVQHSSVGACVEVGKFGLEEEVDRLQRDKNVLMQEL
VRLRQQQQVTEHHLQNVGQKVHVMEQRQQQMMSFLAKAVQSPGFINQFSQQNNDANQHISESNKKRRLPVEDQKNPASHG
VNGLSRQIVRYQSSMNDAANTMLQQIQQMSNSPSHESFSTNHGSFLLGDVPSSNLSDNGSSSNGSSGVTLADVSSNPAGL
YPAMKYHDPCETNQVLETTLPYSPGDLVAPKQGAATSGSSNSDFVGCEIDNGECLDPIMAVLDCPIELEAGAINELLPEV
QDSFWGQFLGETPVIGDTDELISGSVENELIMEHLELQSSLSNGWSKNQQMNHLTEQMGLLTSDALRK*

DNA
ATGGGATCGAGTTGCGAATCTGTACCGACGGCGAACTCTTCCACGGCGGTGGTGGGCTCTATTCCGCCTTTTCTGAGCAA
AACCTACGATATGGTTGACGATCCACTTACGGACGACGTGGTGTCTTGGAGCAGCGGGAACAACAGCTTCGTTGTTTGGA
ACGTGCCTGAGTTCGCCAAACAGTTTCTCCCCAAGTATTTCAAGCACAACAATTTCTCCAGCTTCGTCAGACAGCTCAAT
ACTTATGGCTTCAGAAAAGTTGATCCGGATCGTTGGGAATTTGCAAATGAGGGCTTTTTAAGAGGCCAAAAACAAATACT
AAAGAGTATTGTCCGGCGAAAACCTGCCCAAGTGCAGCCTCAACAACAACCTCAAGTTCAGCACTCATCTGTGGGTGCGT
GCGTTGAAGTGGGCAAGTTTGGACTTGAAGAAGAAGTGGACAGACTCCAGCGGGATAAGAATGTCCTTATGCAAGAACTT
GTAAGATTAAGGCAGCAACAACAAGTTACCGAACATCATCTGCAAAATGTGGGACAGAAAGTTCATGTGATGGAGCAGAG
GCAGCAACAAATGATGTCCTTTCTAGCAAAGGCTGTTCAAAGTCCAGGCTTCATAAACCAGTTTTCCCAGCAGAATAATG
ACGCAAACCAACACATTTCTGAAAGCAACAAAAAGAGGAGGCTACCTGTTGAGGACCAGAAGAATCCAGCCAGTCATGGG
GTTAATGGTCTTAGCCGCCAGATTGTGAGATATCAATCATCGATGAACGATGCAGCAAACACAATGCTCCAACAGATACA
ACAGATGAGTAATTCACCTAGCCATGAATCTTTCTCAACCAATCATGGCAGCTTTCTTTTGGGCGATGTTCCAAGTTCAA
ACCTTTCAGACAATGGGAGCTCTTCAAATGGATCATCTGGAGTTACATTGGCAGATGTTTCATCCAATCCTGCAGGATTA
TATCCTGCAATGAAGTATCACGACCCTTGTGAAACAAATCAAGTCCTGGAGACCACTTTGCCTTATTCTCCAGGTGATCT
CGTAGCTCCAAAGCAAGGAGCAGCAACTTCAGGTAGTTCAAATTCGGATTTTGTTGGATGCGAGATAGATAATGGAGAGT
GTTTGGATCCAATAATGGCTGTTTTGGATTGCCCAATTGAGCTAGAAGCTGGTGCCATAAATGAGTTACTTCCTGAAGTC
CAAGATTCTTTTTGGGGACAGTTCCTTGGTGAAACCCCAGTGATTGGTGACACAGATGAGCTGATCTCAGGATCAGTAGA
AAATGAACTGATAATGGAGCACCTAGAATTACAATCAAGCCTGAGTAATGGGTGGAGTAAGAACCAGCAGATGAACCATC
TTACTGAACAGATGGGACTTCTCACATCAGATGCTCTCAGAAAATGA