Details for Capsella Locus Carubv10013625m

Position : scaf_3 ( 5`- 4411914 .. 4414118 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013625m

Protein [Map View]
MNDSVPESVEDNGNSVLADHNVNGSLVLPDDDHEGVGSPQRSNNVDHFIRVESPAGSVPLTRKGFGLKKWRRIKRDGPVK
DDAAPVDDGSKLLKRNLTGLVNPPSKHVDLSSVEARQSSEGSVGSVNMVHHHHHPGVVNGFSPDPDCIFTVGQASENSEE
HSGNAIGTKNAVGGKIVSGRQGKIWSDTVKSEERVNIEKEKPCSSMDSDLRSSDFVFSSGTVSVANQGEKYERLMMNHIG
GYSKEGQLREEVQTYSRSENGYNGEDQSKKNNSHWTDKDPLADSIRSFAALQEALWKEVQNLQALDKESIPLRSNADGLS
SSDQPRNENSREDNSTSSGSKALILKEKVKHLEHKIEEARAALEEKEAKIQELENSIMESELEGIVQRKIEAEIEHLMLT
KSLSSLQLPQEPKKLHSLTEDPESNREVILGKTCRIGIYISTQLILLVSILWFLVRQYSPASRLAIPT*

DNA
ATGAATGACTCAGTCCCTGAATCCGTGGAAGACAATGGTAACTCAGTACTTGCTGATCATAATGTGAATGGATCATTAGT
ATTGCCTGATGATGATCATGAGGGTGTTGGATCACCTCAACGATCAAACAACGTTGATCATTTTATCAGGGTTGAGTCTC
CGGCTGGATCAGTGCCTTTGACGAGAAAAGGTTTCGGTTTGAAGAAATGGAGAAGGATCAAAAGAGATGGTCCTGTGAAG
GACGACGCTGCTCCTGTTGATGATGGTAGTAAGTTACTGAAGCGTAATTTGACTGGTTTGGTGAATCCTCCTTCTAAACA
TGTGGACTTGTCTTCAGTTGAAGCAAGGCAGAGTAGTGAAGGCTCTGTTGGATCTGTGAATATGGTGCATCATCATCATC
ATCCAGGTGTAGTCAACGGGTTTAGTCCTGATCCTGATTGTATCTTTACTGTTGGCCAAGCGTCTGAGAACAGCGAAGAG
CATAGTGGTAATGCAATAGGTACAAAGAATGCAGTAGGAGGGAAGATTGTTTCAGGTAGGCAAGGAAAAATCTGGAGTGA
TACTGTGAAGAGTGAAGAGCGGGTGAATATCGAGAAGGAAAAGCCTTGTTCGAGCATGGATTCCGACTTGAGAAGTAGTG
ATTTTGTATTTTCAAGTGGCACAGTTTCTGTTGCTAACCAAGGAGAGAAATATGAGAGATTGATGATGAATCATATTGGG
GGATATAGCAAAGAAGGTCAACTTAGGGAGGAAGTTCAAACATATAGCCGAAGCGAAAATGGGTATAATGGAGAAGATCA
GAGTAAGAAAAACAACAGTCATTGGACCGACAAGGATCCACTGGCAGATTCTATCAGAAGTTTTGCAGCTCTGCAGGAAG
CTCTTTGGAAAGAGGTTCAAAATTTACAGGCACTGGATAAGGAATCTATACCACTACGTTCGAACGCTGATGGACTGAGC
TCATCAGACCAGCCAAGAAATGAAAATAGTAGAGAAGATAACTCAACATCCTCAGGATCAAAGGCACTAATCTTGAAGGA
GAAGGTAAAACATCTGGAACACAAAATCGAGGAAGCAAGAGCTGCTCTGGAGGAAAAGGAAGCCAAGATCCAAGAGCTCG
AAAACTCGATAATGGAGTCTGAACTCGAAGGCATTGTCCAGAGAAAAATCGAAGCCGAAATCGAGCATTTGATGCTCACA
AAATCTCTGAGTTCTCTACAGTTACCCCAAGAACCTAAGAAGTTACATTCTTTGACAGAAGATCCCGAATCAAACCGTGA
AGTCATCTTAGGAAAGACATGTAGGATCGGGATCTATATATCGACACAATTGATCTTGCTTGTCTCCATACTTTGGTTTC
TCGTCCGTCAATACTCTCCTGCTTCACGATTAGCTATACCAACTTGA