Details for Capsella Locus Carubv10013622m

Position : scaf_3 ( 5`- 6888861 .. 6893325 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013622m

Protein [Map View]
MSLVVQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNQMEEVISFLETQHKGKYKVYNLCSERLYDVSLFEG
KVASFPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDG
KGLVLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITISDHNGVLFTTKKHPRTKDLSSEDFWFSA
PKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRMILKTSELDAFDKRKLPSPGFMVEVVLADINATI
PTNPSSESASKTPEETSAANSSPVDGSASVPGPNKETEDPDKDDVFSDNEGDSTGPTKTTSSASSQSPEAKQSADETSVL
TKATEKVSISGNNGSSQPVQGEPVSKAGATEKPSGAVVNATSSSESEFKVMAADASVFSFGDEDDFESD*

DNA
ATGTCACTTGTGGTTCAGGAAGGAGGGTTTGATTTGGATCTAACGTACATAACAGAGAACATAATTGCAATGGGGTTTCC
TGCTGGTGATATGAGTTCTGGTTTTTTTGGATATGTCGAGGGTTTCTACCGTAACCAAATGGAAGAAGTTATCAGCTTTC
TTGAAACGCAACACAAGGGAAAATACAAGGTTTACAATCTTTGTTCAGAGAGGTTGTATGATGTATCATTATTTGAAGGG
AAGGTGGCCAGTTTCCCTTTTGATGATCATAATTGTCCGCCAATCCATTTGATCACCTCATTCTGCCAAAGTGCATATTC
ATGGTTAAAGGAGGACATTGAGAATGTTGTGGTTGTTCACTGTAAGGCTGGCATGGCAAGGACAGGGCTTATGATATGTA
GTCTTCTGTTGTATTTGAAGTTCTTCCCGACTGCTGAAGAGTGCATGGACTTCTACAATCAGAAGCGTTGTGTGGATGGA
AAAGGACTTGTGCTACCCAGCCAAATTAGATATGTGAAATACTTTGAACGAATTTTGACCTACTTCAACGGGGAAAATCA
ACCAGGGCGTAGGTGTATGCTTAGGGGATTCCGGCTCCATAGGTGTCCCTATTGGATCAGACCATCCATCACTATTTCAG
ATCATAATGGTGTTCTCTTTACCACGAAAAAACATCCTCGGACCAAGGATCTCTCGTCTGAAGACTTTTGGTTCAGTGCC
CCAAAGAAAGGGGTTATGGTCTTTGCCTTACCCGGAGAGCCAGGTCTAACAGAATTGGCTGGGGACTTCAAAATCCATTT
TCATGACCGCCAAGGAGATTTCTACTGCTGGTTAAACACGACAATGATGGAAAACAGAATGATCCTAAAAACAAGTGAGC
TTGACGCGTTTGACAAGAGGAAGCTACCATCGCCTGGATTTATGGTTGAAGTTGTTCTTGCTGATATAAATGCAACAATC
CCTACGAATCCTAGTTCTGAATCAGCATCCAAAACACCGGAAGAAACTTCTGCAGCTAATTCTTCCCCTGTAGACGGCTC
TGCATCGGTTCCAGGACCCAATAAAGAAACAGAGGATCCTGATAAGGACGATGTGTTCTCTGATAACGAAGGAGACTCAA
CTGGCCCGACCAAAACCACATCATCGGCTTCTTCTCAGAGCCCAGAAGCCAAACAGAGCGCAGATGAAACCTCTGTTCTG
ACGAAAGCAACTGAGAAGGTGTCTATTTCTGGAAACAATGGATCATCGCAGCCTGTGCAAGGGGAACCCGTTAGCAAGGC
TGGAGCGACAGAGAAACCCTCTGGGGCTGTGGTCAATGCTACCTCAAGCTCAGAGAGTGAGTTCAAGGTTATGGCAGCTG
ATGCATCTGTATTCTCATTTGGAGATGAAGACGACTTTGAAAGCGATTGA