Details for Capsella Locus Carubv10013619m

Position : scaf_3 ( 5`- 2214378 .. 2217105 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013619m

Protein [Map View]
MDGMSSYHKRSARLNLCENSSFSHSSRAMAPGNYRYPEVRSPLRRQVHAPSRILKSGLSARTGQVGRDRSTRQVSGNGFG
ADFLTRNYDMVRRDALDFSIPYRTDREMFDVDDECGDVEMIHSDTSMECVENVAMEVDEVEEKADMGSEVVNLKNRSLMV
GDGSQANSSLVLNRPVTDVSSYEAYRKVLESAKDRTSKLKDRGFGGYLKERSRALLRRFFSFWKRDEEPAEDVQREAFLP
LSREEETAVKRVFLANDSNILVAHKNSNIDITGEILRCLRPGEWLNDEVINLYLVLLKDREAREPKKFLKCHFFNTFFFT
KLVNSGTGYNYGAVRRWTSMKRLGYHLKDCDKIFIPIHMNIHWTLAVINIKDRKFQYLDSFKGREPKILDALARYFVDEV
NDKSEVDLDVSGWRQEFVQDLPMQRNGFDCGMFMLKYIDFYSRGLELCFTQEQMPYFRDRTAKEILQLKAE*

DNA
ATGGACGGCATGAGCAGTTACCACAAACGCAGCGCCCGTTTAAACCTTTGTGAAAACTCCAGTTTCTCACATTCATCAAG
AGCCATGGCTCCAGGAAATTACCGTTACCCAGAAGTGAGATCACCGTTGCGGAGACAAGTTCATGCGCCTTCGCGGATCC
TCAAGAGCGGACTCTCTGCTAGGACAGGACAGGTAGGTCGAGACCGTAGCACGCGACAAGTTTCTGGTAATGGGTTTGGA
GCGGATTTTCTCACAAGGAACTATGACATGGTTAGACGAGATGCACTTGATTTTTCTATACCCTATAGAACGGATAGAGA
AATGTTTGACGTTGACGATGAGTGTGGAGATGTGGAAATGATACATAGTGATACAAGTATGGAGTGTGTCGAAAACGTGG
CTATGGAGGTGGACGAGGTGGAAGAGAAGGCAGATATGGGATCTGAGGTTGTTAATCTGAAAAATAGGAGCTTGATGGTG
GGTGATGGTTCTCAAGCTAATAGTTCACTTGTTTTGAATCGCCCTGTGACCGATGTCTCCAGTTATGAAGCATACAGAAA
GGTTCTGGAGAGTGCCAAGGACCGGACTTCCAAACTGAAAGACAGAGGCTTTGGCGGTTATTTGAAAGAGAGAAGTCGTG
CTTTACTGCGACGCTTTTTTTCTTTTTGGAAACGAGATGAAGAACCAGCAGAGGATGTACAACGTGAAGCATTTCTGCCT
CTTTCTAGAGAGGAAGAGACGGCAGTCAAGCGTGTATTCCTAGCTAATGACTCGAACATCTTGGTTGCACATAAGAACTC
AAATATTGACATTACAGGGGAAATCCTGAGGTGCCTTAGACCAGGTGAATGGTTGAATGATGAGGTCATTAATCTTTATC
TGGTATTGCTGAAAGACAGGGAAGCTAGAGAACCAAAGAAGTTTCTAAAATGCCATTTTTTCAATACATTTTTCTTCACT
AAGCTAGTTAATTCGGGGACTGGATACAACTATGGTGCAGTCAGAAGATGGACTTCAATGAAGAGGTTGGGCTACCACCT
CAAAGACTGTGACAAGATATTTATCCCTATCCATATGAACATCCACTGGACGTTGGCTGTAATAAATATAAAGGACCGGA
AATTCCAGTATCTCGACTCATTCAAAGGAAGGGAGCCTAAAATACTCGATGCACTGGCTAGATATTTTGTGGATGAAGTT
AATGACAAGAGTGAAGTAGACCTTGATGTAAGTGGATGGAGACAAGAATTTGTCCAGGACCTTCCGATGCAGAGAAACGG
ATTCGATTGTGGAATGTTTATGCTGAAGTACATAGACTTCTACAGCAGAGGTCTGGAACTTTGTTTCACGCAGGAACAAA
TGCCATATTTCCGGGATAGGACAGCGAAGGAGATTCTGCAACTGAAAGCTGAGTGA