Details for Capsella Locus Carubv10013618m

Position : scaf_3 ( 5`- 1096315 .. 1099765 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013618m

Protein [Map View]
MTAKRAIGRHESLADKIHRHRGLLLVISIPIVLIALVLLLMPGTSTSVSVIEYTMKNHEGGSTSRGPRNYAVIFDAGSSG
SRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRALGHK
ASENILQAVRELLKDRSRLKTEANAVTVLDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAAT
APKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCMVTGYAGNYKYGGKAFKATASSSGASLD
ECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDRAAEAGFVDPKQPVAEVRPLDFEKAANKACSMR
MEEGKSKFPHVEEDNLPYLCLDLVYQYTLLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSSP*

DNA
ATGACGGCGAAGCGAGCGATCGGACGGCACGAATCTCTTGCTGATAAGATCCATCGACATAGAGGTCTTCTACTTGTGAT
TTCGATTCCCATTGTGTTAATCGCACTTGTGCTTCTACTAATGCCGGGGACATCGACGTCCGTCTCTGTCATTGAGTACA
CGATGAAAAACCACGAGGGAGGTTCGACTTCGAGGGGTCCGAGGAATTACGCTGTGATTTTCGATGCTGGAAGTTCTGGA
AGCCGTGTGCATGTTTATTGTTTCGACCAGAATTTGGATCTCGTTCCTTTGGAGAATGAGCTCGAGCTCTTCTTACAGCT
AAAACCGGGTTTAAGTGCATATCCTAATGATCCTCGGCAATCAGCAAATTCTTTGGTATCTCTTCTAGATAAAGCAGAAG
CTTCTGTTCCTCGTGAGTTGCGACCAAAGACTCCTGTCAGAGTTGGGGCAACTGCAGGCTTGAGGGCTTTGGGTCACAAA
GCTTCTGAAAACATCTTGCAAGCGGTAAGGGAGCTCCTGAAAGATAGAAGCAGGCTGAAGACCGAGGCAAATGCAGTGAC
TGTTCTGGATGGAACTCAGGAAGGTTCTTATCAGTGGGTGACAATTAACTACCTGCTAAGGACTTTGGGAAAGCCGTACT
CAGATACAGTTGGAGTGGTTGACCTTGGAGGGGGCTCGGTTCAAATGGCATATGCTATACCAGAGGAAGATGCTGCAACT
GCACCAAAACCATTAGAAGGCGAGGATTCTTATGTCAGAGAAATGTATCTGAAGGGACGGAAGTATTTCCTCTATGTTCA
TAGCTACCTACATTACGGGTTACTTGCTGCCCGAGCTGAGATTTTGAAAGTTTCTGAGGACTCCAACAACCCCTGCATGG
TGACCGGCTACGCTGGTAATTACAAATATGGAGGAAAAGCGTTCAAAGCCACAGCTTCTTCATCCGGTGCAAGTCTAGAT
GAATGCCGGCGAGTAGCTATTAATGCACTCAAAGTCAATGATTCACTGTGCACCCACATGAAATGCACTTTTGGTGGAGT
ATGGAATGGTGGAGGCGGTGGTGGCCAAAAGAAAATGTTCGTTGCATCATTTTTCTTTGATCGAGCTGCAGAGGCTGGTT
TTGTTGACCCAAAGCAACCTGTGGCTGAGGTTCGACCACTTGACTTTGAGAAAGCGGCCAACAAAGCTTGTAGCATGAGA
ATGGAAGAAGGGAAATCGAAATTTCCACACGTGGAGGAAGATAATCTTCCTTACTTGTGCTTGGATCTTGTTTACCAATA
TACTCTTCTCGTCGATGGATTCGGATTGAAGCCATCACAAACAATAACGTTAGTGAAGAAGGTGAAATACGGAGATTACG
CCGTGGAAGCTGCTTGGCCACTAGGAAGCGCCATAGAAGCAGTATCCTCACCATGA