Details for Capsella Locus Carubv10013595m

Position : scaf_3 ( 5`- 9551591 .. 9554870 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013595m

Protein [Map View]
MDEDFEMPPVGGMNDDEDMDFGDAASFLKVGEEKEIQQGLKKKLLKEGDGYETPDNGDEVEVHYTGTLLDGTKFDSSRDR
GTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYGESGSPPTIPANATLQFDVELLTWVSVKDICKDGGVFKKI
LAVGEKWENPKDLDEVFVKFEAKLDNGTVVGKSDGVEFTVKDGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAS
AGEGAVPPNATLEINLELVSWNTVSEVTDDNKVMKKILKEGEGYERPNEGATVKVKLIGKLEDGTVFLKKGHGEDGELFE
FKTDEEQVVDGLDRAVMKMKKGEVALVTVAPEYAFGSNESQQELAVVPPNSTVYYEVDLVTFDKERESWDMNTEEKIEAA
GKKKEEGNSKFKAGKYALASKRYEKAVKFIEYDTSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVIIG*

DNA
ATGGATGAAGATTTCGAGATGCCTCCGGTCGGTGGAATGAACGACGACGAAGACATGGATTTCGGTGACGCCGCCTCGTT
TCTTAAAGTCGGTGAGGAGAAAGAGATCCAACAAGGTTTGAAGAAGAAGCTTCTTAAGGAAGGTGATGGATACGAGACTC
CTGATAATGGCGATGAAGTTGAAGTGCATTACACTGGGACTTTGTTGGACGGGACGAAGTTTGATTCGAGCCGTGATAGA
GGAACGCCTTTTAAATTCACTCTTGGACAAGGTCAGGTTATTAAAGGATGGGATATTGGTATTAAGACAATGAAGAAAGG
TGAAAATGCTGTTTTCACTATCCCGTCAGAGCTAGCATATGGGGAATCTGGTTCACCGCCAACAATTCCTGCGAATGCCA
CGCTTCAGTTTGATGTGGAGTTGCTTACATGGGTTAGTGTGAAGGACATATGCAAGGATGGTGGTGTGTTTAAGAAGATT
CTTGCTGTGGGAGAGAAGTGGGAGAACCCAAAGGATCTCGATGAAGTTTTTGTTAAGTTCGAGGCTAAACTTGACAATGG
TACCGTTGTTGGGAAATCTGACGGTGTAGAATTCACTGTTAAAGATGGCCATTTCTGCCCTGCACTTGCTAAGGCTGTGA
AAACCATGAAAAAGGGTGAAAAGGTTCTTTTGACAGTTAAACCACAATATGGTTTTGGGGAAAAGGGCAAGCCAGCCTCT
GCTGGTGAAGGTGCTGTTCCTCCAAATGCTACACTTGAGATCAATCTGGAGTTAGTTTCCTGGAATACAGTTTCAGAAGT
AACTGATGATAACAAGGTTATGAAAAAAATCTTGAAAGAAGGGGAAGGATATGAGCGTCCTAATGAGGGGGCAACTGTGA
AAGTGAAATTGATAGGAAAACTTGAAGATGGAACTGTATTCCTGAAGAAAGGTCATGGTGAGGATGGGGAACTGTTTGAG
TTCAAAACTGATGAAGAGCAAGTGGTCGATGGACTTGATAGAGCTGTCATGAAGATGAAAAAGGGTGAAGTCGCATTGGT
GACAGTAGCACCTGAATATGCCTTTGGTTCTAATGAGTCACAACAGGAATTGGCTGTGGTGCCGCCCAACTCAACTGTCT
ACTATGAGGTTGATCTTGTGACATTCGACAAGGAAAGGGAATCGTGGGACATGAACACAGAAGAAAAGATTGAAGCTGCA
GGTAAGAAGAAGGAAGAAGGAAATTCCAAGTTTAAAGCAGGCAAATATGCCCTGGCGTCCAAGAGATATGAGAAGGCTGT
TAAATTCATTGAATACGACACATCCTTCAGTGAAGAGGAGAAGAAGCAAGCAAAAGCATTGAAGGTGGCATGCAATCTAA
ACGATGCAGCTTGCAAACTCAAATTGAAAGATTACAAGCAGGCTGAAAAACTATGCACAAAGGTAATAATTGGTTAG