Details for Capsella Locus Carubv10013586m

Position : scaf_3 ( 5`- 9240817 .. 9243293 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013586m

Protein [Map View]
MNRQGGGQRLRSARPTTIHDCALSGDLIALQRLLKDNPSLLNERNPVMYHTPLHVSAGNGNVDIVKYLLAWTGSDKVELE
AMNTYGETPLHMAAKNGCNEAAKLLLESGAFIEAKASNGMTPLHLAVWYSITSKDISTVKTLLDNNADCSAKDNEGMTPL
DHLPKGQGSEKLRELLRWFLQEQRKRSALEQCGKTKAKMELLEDELSNIVGLSELKTQLRKWAKGMLLDERRRALGLNIG
NRRPPHMAFLGNPGTGKTMVARVLGKLLNTVGILPTDKVTEVQRTDLVGEFVGHTGPKTRRKIQEAEGGILFVDEAYRLI
PMQKADDKDYGLEALEEIMSVMDTGKIVVIFAGYSEPMKRVIASNEGFCRRVTKFFNFSDFSAKELAQILHIKMSNQGED
TLFYGFSLHESCTLQEIASLIERETTEKQRKEMNGGLVDTLLVNARENLDLRLSFECVDTEEICTIKLEDLEAGLRVFSQ
*

DNA
ATGAACCGACAAGGCGGTGGACAACGGCTGAGATCAGCTAGACCCACCACAATTCACGACTGTGCTCTCTCCGGCGATCT
TATTGCGTTGCAGAGGCTTCTTAAAGACAACCCTTCTCTTCTCAATGAACGCAATCCCGTTATGTATCATACGCCTCTTC
ATGTTTCTGCTGGTAATGGTAATGTTGATATAGTTAAGTATCTTCTCGCTTGGACTGGATCTGATAAAGTTGAATTGGAA
GCAATGAATACTTATGGTGAGACTCCATTGCACATGGCAGCCAAGAACGGTTGCAATGAAGCTGCAAAGCTACTTCTTGA
GAGTGGTGCTTTTATTGAAGCTAAAGCCAGCAACGGTATGACGCCATTGCACCTTGCGGTATGGTACTCAATTACTTCGA
AAGACATCTCTACTGTTAAGACACTGCTCGATAATAATGCAGATTGCAGTGCTAAAGATAATGAAGGGATGACTCCTTTG
GATCATCTACCTAAAGGGCAAGGCAGTGAGAAGTTAAGGGAGTTGTTGCGCTGGTTTCTTCAAGAGCAGAGGAAAAGAAG
TGCGCTTGAGCAGTGTGGTAAGACAAAAGCCAAGATGGAACTACTTGAGGACGAGTTGTCAAATATTGTTGGATTAAGTG
AGCTGAAGACACAACTGAGGAAATGGGCAAAAGGAATGCTTCTAGATGAGAGGAGAAGGGCTCTTGGCCTAAACATTGGG
AATAGAAGACCTCCGCATATGGCATTTCTTGGAAACCCTGGAACAGGTAAGACCATGGTGGCTCGAGTTCTCGGGAAGTT
GCTTAACACAGTTGGAATTTTACCAACCGATAAGGTAACAGAAGTACAGCGTACGGACTTGGTTGGTGAGTTTGTTGGCC
ATACAGGGCCAAAGACCAGGAGAAAGATCCAAGAAGCTGAGGGAGGAATTCTGTTTGTGGATGAAGCATACCGGTTGATC
CCGATGCAAAAGGCGGATGACAAGGACTATGGTCTAGAAGCTCTCGAAGAAATCATGTCTGTCATGGACACAGGGAAAAT
CGTGGTGATATTCGCTGGATACAGCGAGCCCATGAAGCGTGTGATAGCATCGAACGAAGGGTTTTGCAGAAGGGTCACAA
AGTTTTTCAATTTCAGCGACTTTAGTGCCAAAGAACTGGCCCAGATACTACACATCAAGATGAGCAACCAAGGAGAGGAC
ACTCTGTTCTATGGCTTCAGTTTGCATGAGTCGTGCACCCTGCAGGAGATAGCATCACTGATTGAGAGGGAAACAACCGA
GAAGCAGAGGAAAGAGATGAATGGAGGATTGGTCGACACGCTACTTGTTAACGCGAGGGAGAATCTTGATCTCCGACTTA
GCTTTGAGTGTGTTGACACTGAAGAGATTTGCACAATCAAGTTAGAGGATCTAGAAGCCGGACTTCGTGTTTTCTCTCAG
TGA