Details for Capsella Locus Carubv10013585m

Position : scaf_3 ( 5`- 2746377 .. 2748723 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013585m

Protein [Map View]
MWRLTAVTSLLKRNNYILQRHGSSHAVAQRTTTSVRETETKVPKMPPFNYSPQPYDGPSTAEIIAKRREFLSPALFHFYN
TPLNIVEGKMQYVFDETGRRYLDAFGGIATVSCGHSHPQVVDSVIKQLKLIQHSTILYLNHTISDFAEALVSNLPGDLKV
VFFTNSGTEANELAMMMARLYTGFNDIVSLRNSYHGNAAATMGATAQSNWKFNVVQSGVHHAINPDPYRGIFGSDGEKYA
SDVQDLIQFGTSGQIAGFIGESIQGVGGIVELAPGYLPAVYDIVRRAGGVCIADEVQSGFARTGTHFWGFQSHGVVPDIV
TMAKGIGNGIPLGAVVTTPEIASVLSRRSYFNTFGGNPMCTAAGHAVLRVIHEEKLQENALLVGSHLKHRLTLLKNKYEL
IGDVRGRGLMLGVEFVIDRDLKTPAKTETIHLMDQLKEMGVLVGKGGFYGNVFRITPPLCFTLSDADFLVDAMDHAMSKI
*

DNA
ATGTGGAGGTTAACGGCGGTTACTTCACTACTGAAACGGAACAATTATATTCTTCAGCGTCATGGCTCCTCACATGCAGT
AGCTCAGAGAACAACAACCTCCGTTCGCGAGACCGAGACAAAAGTTCCGAAAATGCCCCCGTTCAATTATTCTCCGCAGC
CTTACGACGGTCCCTCCACCGCAGAGATCATAGCAAAGCGGCGAGAGTTCCTCAGCCCGGCTCTGTTTCACTTCTACAAC
ACACCCTTAAACATTGTGGAGGGAAAGATGCAGTATGTGTTCGACGAGACGGGACGGCGATATTTAGATGCTTTCGGAGG
CATAGCAACGGTTTCGTGCGGCCATAGCCACCCGCAAGTAGTTGACTCCGTCATCAAACAACTAAAACTTATTCAACACT
CCACCATCCTTTATCTTAACCACACAATCTCCGACTTTGCTGAAGCCCTCGTCTCCAATCTTCCCGGGGATCTCAAGGTA
GTGTTTTTCACGAATTCGGGTACGGAGGCGAATGAGCTGGCGATGATGATGGCTAGGCTATATACAGGATTTAACGACAT
CGTTTCGCTGAGGAACTCTTATCATGGAAACGCAGCTGCCACTATGGGAGCTACTGCTCAGTCCAACTGGAAGTTTAACG
TCGTTCAGAGCGGAGTTCATCACGCCATAAATCCAGATCCTTACAGAGGAATATTTGGATCCGACGGTGAGAAGTATGCA
AGTGACGTACAAGACCTTATCCAATTCGGAACTTCCGGACAAATTGCCGGTTTCATCGGCGAATCTATCCAGGGAGTTGG
AGGAATCGTTGAGCTAGCACCGGGATATTTACCGGCGGTGTACGATATTGTGAGGAGAGCCGGAGGAGTTTGCATCGCCG
ATGAAGTCCAATCCGGTTTCGCTCGTACCGGAACCCATTTCTGGGGATTCCAATCGCATGGTGTTGTCCCTGACATCGTC
ACCATGGCTAAGGGGATCGGTAACGGTATACCACTTGGAGCGGTTGTAACAACACCGGAGATCGCCAGCGTTTTAAGTCG
TCGGAGTTACTTTAATACCTTCGGCGGAAACCCAATGTGCACGGCCGCAGGACACGCAGTCCTTAGGGTCATTCATGAAG
AGAAGCTCCAAGAGAACGCTTTGCTCGTTGGCTCACATCTCAAACATAGACTTACACTACTCAAAAACAAATACGAACTC
ATCGGAGATGTGAGAGGAAGAGGATTGATGTTAGGAGTTGAGTTTGTCATAGACCGTGACTTAAAAACTCCTGCTAAAAC
AGAGACCATTCATTTAATGGATCAACTCAAAGAAATGGGAGTGTTGGTGGGGAAAGGTGGATTCTATGGGAACGTATTCA
GAATCACTCCTCCTCTCTGCTTTACCCTCTCCGACGCTGATTTCCTTGTGGATGCGATGGATCACGCCATGTCCAAGATT
TGA