Details for Capsella Locus Carubv10013584m

Position : scaf_3 ( 5`- 757183 .. 759512 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013584m

Protein [Map View]
MAPVSLPPGFRFHPTDEELITYYLKRKINGLEIELEVIAEVDLYKCEPWDLPGKSLLPSKDQEWYFFSPRDRKYPNGSRT
NRATKGGYWKATGKDRRVSWRDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRLDETECEPSAYGMQDAYALCRVFKKIVI
EAKPRDQHRSYVHAMPNVSGNGSSSFDNCSDLEISSATHQVQNTFQPRFGNERFNSNAISNEDWSQFYGSSYRPFPTPYK
VNTEIECSMLRHNVSLPPLRVENSAVNDCDFFTSMTHNNDHGVFDDFTFVASNSNHYNSVGDQVIHVGNYVDQLMTSNHH
LNQAGYLEEQKIIPSLDDTDHQNLGFHGNNTNEDHIDIDDFFSFDKYNEENVNRIEDNNEQLDTNETLDSSGFEVVEEET
RFNNQMLISTYQTTKIQYHQVVPSHTLKVHVNHNNVEERTLFIEEDKDSWLQRAEKITKTKLTLCSLMAQQYYKCLAIFF
*

DNA
ATGGCTCCTGTCTCGTTACCTCCAGGTTTCAGATTCCATCCAACGGACGAGGAACTAATTACTTACTATCTAAAAAGAAA
GATCAACGGTCTAGAAATTGAACTTGAGGTTATCGCTGAAGTTGATCTCTACAAGTGTGAGCCATGGGACTTACCAGGAA
AATCTTTGCTTCCGAGCAAAGACCAAGAATGGTACTTCTTCAGCCCACGTGACCGGAAGTACCCTAACGGCTCAAGGACA
AACCGCGCAACCAAAGGCGGTTATTGGAAGGCCACTGGCAAAGACCGTCGTGTGAGTTGGAGAGACCGAGCCATTGGAAC
CAAGAAGACACTGGTTTACTACCGTGGCCGTGCGCCACATGGTATTAGAACCGGTTGGGTCATGCACGAATATCGACTCG
ATGAAACCGAATGCGAGCCTTCTGCGTACGGCATGCAGGATGCATATGCACTTTGTCGTGTGTTCAAAAAGATTGTGATT
GAAGCTAAGCCAAGAGATCAGCATCGGTCATATGTCCACGCGATGCCGAATGTGAGCGGTAACGGCTCATCGAGTTTTGA
CAATTGTTCAGATCTCGAAATCAGTTCAGCTACTCATCAAGTTCAAAACACATTCCAACCGCGATTTGGCAACGAGCGTT
TTAACTCCAACGCAATCAGCAACGAGGACTGGTCACAATTCTACGGCTCTTCTTATAGACCATTCCCTACTCCATATAAG
GTTAATACAGAGATCGAATGTTCAATGTTACGACACAATGTATCTCTACCACCGTTGCGTGTAGAGAACTCTGCGGTTAA
TGATTGCGATTTCTTCACGAGTATGACTCACAACAACGATCATGGCGTTTTTGACGACTTTACTTTCGTTGCAAGTAACT
CCAACCACTATAATAGCGTTGGGGATCAAGTGATCCACGTTGGCAATTATGTTGACCAATTGATGACGTCTAATCATCAT
TTGAACCAGGCCGGTTATTTAGAAGAGCAAAAGATCATACCGAGTTTGGATGATACTGATCACCAAAATCTTGGATTTCA
TGGGAACAATACCAATGAGGACCACATAGATATCGATGATTTTTTCTCATTTGATAAATATAACGAGGAAAACGTGAATA
GAATAGAAGACAATAATGAACAGTTGGATACAAATGAAACACTTGATTCATCAGGATTCGAGGTGGTTGAAGAAGAAACT
AGATTTAACAACCAAATGCTCATTTCGACATATCAAACAACGAAGATTCAATATCACCAAGTCGTGCCTTCTCACACGTT
GAAAGTTCACGTCAATCACAATAATGTGGAAGAAAGAACATTGTTTATCGAAGAGGACAAAGATTCTTGGTTACAAAGAG
CTGAGAAGATCACCAAGACAAAACTAACACTTTGTAGTTTAATGGCTCAGCAATACTACAAATGTCTTGCGATTTTTTTC
TGA