Details for Capsella Locus Carubv10013582m

Position : scaf_3 ( 5`- 4160459 .. 4163217 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013582m

Protein [Map View]
MASTAASRAFSFFKSTGGVASSDATRARASLLPIPSTSVSARPLGFSATLDSRRFSLHVASKVESVRGKGSKGVVSMAKK
SVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRLS
ELLGIQVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLAALADLYVNDAFGTAHRAHASTEGVTK
FLKPSVAGFLLQKELDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEE
DKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMG
VFEMEKFAAGTEAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAIPVT
V*

DNA
ATGGCTTCAACCGCCGCAAGTCGCGCCTTTTCCTTCTTTAAGTCCACCGGCGGCGTAGCTTCCTCCGACGCAACTCGTGC
ACGCGCCTCTCTCTTGCCAATTCCCTCTACCTCTGTATCCGCGCGTCCTCTTGGCTTCTCCGCCACTCTCGATTCCCGTC
GTTTCTCCCTCCACGTTGCTTCCAAGGTTGAATCAGTGCGGGGGAAGGGGAGCAAAGGAGTGGTTTCTATGGCGAAGAAG
AGCGTCGGAGATCTGACCTCAGCTGATTTAAAGGGGAAGAAGGTTTTCGTGAGAGCTGATCTCAATGTACCTCTCGATGA
TAACCAGACTATCACCGATGATACCAGAATCCGTGCAGCTATTCCAACAATCAAGTATTTGATTGAAAATGGTGCTAAAG
TCATCCTCTCCACTCATCTGGGAAGGCCAAAGGGAGTCACACCAAAGTTCAGTTTGGCTCCCCTTGTCCCTAGGCTCTCC
GAGCTTCTTGGTATTCAGGTCACCAAAGCTGATGATTGTATCGGTCCGGAAGTGGAAAGCCTTGTCGCTTCTCTTCCTGA
AGGTGGAGTTTTGCTTCTTGAGAACGTCAGGTTTTACAAGGAGGAAGAAAAGAACGATCCTGAGTTTGCCAAGAAGCTTG
CTGCATTAGCTGACCTCTATGTTAATGATGCTTTCGGAACTGCTCACAGAGCTCATGCTTCTACCGAAGGAGTCACTAAG
TTCTTGAAGCCTTCAGTTGCTGGTTTCCTTCTGCAGAAGGAGCTGGACTACCTTGTTGGTGCTGTTTCAAACCCAAAGAG
ACCATTTGCAGCCATAGTGGGTGGATCCAAGGTCTCGTCCAAAATTGGAGTTATTGAATCGCTTCTGGAGAAGTGTGATA
TCCTTCTTCTTGGTGGTGGAATGATCTTTACATTCTACAAGGCACAAGGTCTTTCAGTTGGTTCCTCCCTTGTTGAAGAA
GACAAACTTGAATTGGCTACAGAACTCCTTGCCAAAGCTAAGGCCAAAGGAGTCTCTCTTTTGTTGCCAACAGATGTTGT
GGTTGCTGACAAATTTGCTCCTGATGCAAACAGCAAGATCGTGCCTGCATCAGGCATTGAGGACGGATGGATGGGATTGG
ACATCGGTCCAGACTCTATTAAAACTTTCAATGAAGCTCTGGACACAACACAAACAGTTATTTGGAATGGACCTATGGGA
GTTTTCGAGATGGAAAAGTTTGCGGCTGGAACAGAGGCGGTAGCCAATAAACTAGCTGAGCTAAGTGGAAAGGGTGTGAC
AACGATAATAGGAGGAGGAGACTCAGTGGCTGCTGTCGAGAAAGTAGGAGTAGCAGGAGTCATGAGTCACATCTCCACTG
GTGGTGGAGCCAGCTTGGAGCTGTTGGAAGGCAAAGTACTTCCCGGTGTTGTCGCCCTTGATGAAGCGATCCCAGTCACC
GTTTAG