Details for Capsella Locus Carubv10013580m

Position : scaf_3 ( 5`- 8293653 .. 8297462 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013580m

Protein [Map View]
MEKPVFAPWRSDPVFRPPETPLEPMEFLSRSWSVSAHEVSKALTPPQQLLSKPSIESTTVILEEEPQQPIAAGENETEEN
GLVSGNPFSFACSETSQMVMDRILSQSQEVSPRTSGRLSHSSGPLNGSLTDSPPISPHEVDDIKQFCRTNNNINNYNSQF
RSTGSTPGPITATTTQSKTVGRWIKDRREKKKEETRAHNAQIHAAVSVAGVAAAVAAIAAATAASSSYGKDENMAKTDMA
VASAATLVAAQCVEAAEVMGAERDHLASVVSSAVNVRSAGDIMTLTAGAATALRGVATLKARAMKEVWNIASVIPMDKGI
NPGGCSNVNGNSNGSNGSSSSSHSGEFLVEDNFLGHCNREWLARGCQLLKRTRKGDLHWKIVSVYINRLNQVMLKMKSKH
VGGTFTKKNKNVVIDVIKNIPAWPGRHLLEGGEDLRYFGLKTVPRGIVEFECRSQREYEMWTQGVSRLLAVAAERNNRYR
I*

DNA
ATGGAAAAACCAGTGTTTGCACCATGGCGGTCCGACCCAGTTTTCCGGCCACCGGAGACACCGTTAGAGCCGATGGAGTT
TCTCTCTCGCTCTTGGAGCGTTTCAGCTCACGAAGTCTCCAAAGCCCTCACTCCTCCTCAGCAACTCCTCTCAAAACCTT
CAATCGAAAGCACAACCGTCATTCTCGAAGAGGAACCACAACAACCCATCGCCGCCGGCGAGAACGAGACGGAGGAGAAC
GGTTTAGTCTCCGGAAACCCTTTCTCTTTCGCTTGCTCCGAGACTTCTCAGATGGTCATGGATCGTATCTTGTCTCAGTC
TCAGGAAGTGTCTCCACGAACATCTGGTCGGCTTTCTCACAGCAGCGGTCCTCTCAATGGTTCTTTAACCGACAGTCCTC
CGATTTCGCCTCATGAAGTCGACGACATTAAGCAATTTTGCAGAACAAACAACAATATAAACAACTACAACTCTCAGTTC
CGTTCCACGGGCTCAACTCCAGGACCTATCACTGCAACAACCACACAGTCCAAGACTGTGGGACGGTGGATCAAAGACCG
GAGGGAGAAAAAGAAGGAAGAGACGAGGGCTCACAATGCTCAGATACACGCTGCTGTCTCTGTTGCTGGCGTGGCTGCAG
CGGTGGCTGCGATCGCGGCTGCAACTGCTGCTTCATCGAGCTATGGGAAAGATGAGAATATGGCTAAAACGGATATGGCT
GTGGCTTCTGCTGCAACACTTGTGGCTGCTCAATGTGTGGAGGCTGCTGAAGTTATGGGAGCTGAGAGGGATCATTTAGC
CTCAGTTGTTAGCTCTGCTGTTAATGTTCGATCCGCGGGAGATATCATGACACTAACTGCTGGAGCAGCCACAGCGTTAA
GAGGAGTAGCTACATTGAAGGCGAGGGCAATGAAGGAGGTGTGGAACATTGCATCAGTTATTCCAATGGATAAAGGAATC
AATCCTGGAGGTTGTAGCAATGTTAATGGTAATAGTAACGGTAGCAATGGTAGCTCGAGCAGCAGTCACAGTGGCGAATT
TCTAGTTGAGGATAATTTCTTGGGACATTGCAACAGAGAATGGCTCGCTCGGGGTTGCCAACTCCTCAAACGCACCCGCA
AAGGAGATCTTCATTGGAAAATAGTCTCAGTTTACATAAACAGGCTAAATCAAGTTATGTTGAAGATGAAGAGCAAGCAT
GTTGGAGGGACCTTCACAAAGAAGAATAAAAATGTTGTGATTGATGTGATCAAAAACATTCCGGCTTGGCCAGGCCGCCA
TTTGCTAGAAGGAGGAGAGGATTTGAGATACTTTGGATTAAAGACAGTTCCCCGAGGGATAGTAGAATTTGAGTGCAGAA
GCCAGAGAGAGTATGAAATGTGGACACAAGGTGTCTCAAGGCTTCTTGCTGTTGCTGCCGAGAGGAATAATAGATATAGG
ATATGA