Details for Capsella Locus Carubv10013579m

Position : scaf_3 ( 5`- 5785952 .. 5789902 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013579m

Protein [Map View]
MTMVGLNAEVEPQSLKKLSLKSVKRALDLFAPLHGQFPPPDPESKKIRLCHKVQVAFGGVELEPASKPTRRADHNSEKTA
PSNALARPGPEKSKELRKGTTEKALVVGPTLPRSDLNNTAYTGKSIAILPASGSSSERNLSTTFLMERRSSRWPRPEWHA
PWKNYRVIQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMISAGDDKQVKC
WDLEQNKVIRSYHGHLHGVYCLALHPTLDVLLTGGRDSVCRVWDIRTKMQIFALSGHTADVFSVFTCPTDPQVVTGSHDS
TIKFWDLRYGTTMATLTNHKSTVRTMVPHPKENAFVSASADNIKKFSLPKGEFCHNMLSQQKDIINAVAVNEDGVMVTGG
DKGSLWFWDWKSGHNFQQAETIVQPGSLESEAGIYAACYDKTGSRLVTCEVDKTIKMWKEDENATPETHPLNFKPPRDIR
RY*

DNA
ATGACGATGGTGGGTTTGAACGCCGAGGTCGAACCACAGTCGCTGAAAAAGCTCAGTCTCAAATCTGTTAAACGAGCTCT
TGATCTTTTCGCTCCCCTCCATGGCCAATTTCCTCCGCCTGATCCTGAAAGCAAAAAAATCCGGCTCTGCCATAAGGTTC
AAGTTGCATTTGGAGGCGTAGAACTAGAACCTGCAAGTAAGCCTACACGCCGTGCTGACCATAACAGTGAAAAGACGGCT
CCATCAAATGCCCTTGCCCGTCCAGGGCCTGAAAAGTCCAAGGAACTTCGGAAAGGCACAACAGAGAAAGCTTTAGTTGT
TGGTCCAACTTTACCGCGAAGTGACTTGAACAATACTGCTTACACAGGCAAAAGCATTGCGATTCTTCCTGCATCTGGAT
CCTCATCTGAAAGAAATCTGTCAACTACTTTTTTAATGGAGAGAAGATCTAGTAGATGGCCCCGTCCAGAGTGGCATGCA
CCATGGAAGAATTACAGGGTGATCCAGGGACACTTGGGTTGGGTCAGATCTGTTGCGTTTGACCCAAGTAATGAATGGTT
TTGCACTGGTTCAGCTGATCGCACCATCAAGATATGGGATGTAGCGACTGGAGTTCTGAAGCTCACACTTACTGGACACA
TTGGGCAAGTACGAGGCCTCGCTGTAAGCAATAGACATACCTATATGATTTCTGCTGGTGATGACAAGCAAGTCAAATGC
TGGGACCTTGAGCAAAATAAGGTTATTCGATCTTATCATGGTCATCTGCATGGCGTCTACTGTTTAGCTCTTCATCCAAC
TCTAGATGTTTTACTAACTGGAGGGCGAGACAGTGTCTGCAGGGTATGGGATATCCGTACGAAGATGCAAATTTTTGCAC
TCTCAGGACATACCGCGGATGTTTTTTCTGTTTTCACCTGCCCAACTGACCCACAAGTTGTTACCGGGTCTCATGACTCA
ACCATCAAATTTTGGGACCTCCGATATGGCACAACGATGGCAACTCTAACGAATCATAAGAGCACTGTCCGAACAATGGT
GCCCCATCCAAAAGAGAATGCTTTTGTTTCTGCATCAGCTGACAACATCAAGAAATTTAGCCTTCCTAAGGGAGAGTTTT
GCCACAACATGCTTTCTCAGCAGAAAGACATAATTAACGCAGTAGCTGTGAACGAGGATGGTGTAATGGTCACAGGAGGT
GATAAAGGAAGCTTATGGTTCTGGGACTGGAAGAGTGGCCACAATTTCCAACAGGCAGAAACTATTGTACAACCCGGTTC
GCTGGAGAGTGAAGCTGGTATATATGCCGCATGTTATGATAAGACGGGTTCAAGGCTGGTAACATGTGAGGTAGACAAGA
CAATAAAGATGTGGAAGGAAGATGAAAATGCAACTCCTGAAACTCATCCTCTCAACTTTAAACCTCCGAGAGATATCAGG
CGCTACTAA