Details for Capsella Locus Carubv10013577m

Position : scaf_3 ( 5`- 1556181 .. 1558422 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013577m

Protein [Map View]
MVARTPQKLRKVTMVVPSLNSDLLKETINKVDKCMERLQELQYTIAGGTKVVSGVNLSPRSTRTYLKTSLRCKQETLRIK
NATNKKSPVGKFPASSPGDWRKMSLPAMLLGETVNEILQASQVTRDIVEAIAPKKCRKSRRLTMSQEDDGPKTPETRRRK
SREPNPETVNSNIKARRKKEKQNKRSESDSPPSLQRARSRIAFRTISPPLKTAENVQVKGNGENSFRHLANRVSPKHKPW
VKKAVLFPNPLFISGTATQQAKFSRTMSPVIARNEISSIKNNKETPHKFLIKSPPKSASKFQVKIKSPPKVLVSPTRNGS
NLIRRSPRGSSSPTRNVNIGKKSPSASISPVRNLGKRSPKLSTAAKLRRSFTPTRNGSNLTRKSSMSPTRVTLQAFISPA
RNGNFNKKSLKASISPTRVNKPQKLSTAAKLRRSFSPSRLAMRLVSPMKSRKSVAKCDDHEMVSGLKQRPVMVPKRFSMG
RI*

DNA
ATGGTTGCAAGAACCCCACAAAAGCTGAGGAAAGTGACGATGGTGGTGCCATCTCTCAACTCAGATCTTCTCAAAGAAAC
TATCAACAAGGTTGACAAATGTATGGAAAGACTGCAAGAGCTACAATACACAATAGCTGGAGGTACCAAAGTTGTCTCTG
GAGTGAACCTTAGCCCTCGGAGTACCAGAACTTACTTGAAGACTAGTCTTAGATGCAAGCAAGAAACTTTAAGGATCAAG
AATGCTACCAATAAGAAATCTCCAGTAGGGAAGTTTCCAGCTTCCTCACCAGGAGATTGGAGGAAAATGTCACTCCCAGC
AATGTTACTGGGAGAGACTGTAAATGAAATCTTACAAGCCTCACAAGTCACAAGAGACATTGTAGAAGCCATAGCGCCAA
AGAAATGTAGAAAGTCCAGGAGATTAACAATGTCACAAGAAGATGATGGACCTAAAACACCTGAGACACGAAGACGTAAA
TCCCGGGAACCAAACCCTGAAACTGTTAATAGCAATATCAAAGCGAGAAGGAAGAAAGAGAAGCAGAACAAACGATCAGA
ATCAGATTCTCCTCCTTCTCTACAAAGGGCTCGCTCAAGAATTGCATTCAGAACCATCTCTCCTCCACTAAAAACAGCAG
AGAATGTTCAAGTAAAGGGAAATGGTGAGAATAGCTTTCGGCATTTGGCTAACAGGGTTTCACCAAAGCACAAACCTTGG
GTTAAAAAGGCGGTTCTTTTTCCAAACCCTCTGTTTATTTCTGGTACAGCTACACAACAAGCCAAGTTCAGTAGAACAAT
GTCTCCGGTCATAGCCAGAAATGAGATTTCCAGCATCAAGAACAATAAAGAGACGCCACACAAGTTCTTGATCAAATCTC
CTCCCAAATCAGCATCTAAGTTTCAGGTCAAGATCAAGAGCCCACCTAAGGTATTGGTTTCTCCTACAAGAAATGGCAGT
AACTTGATTCGGAGGTCACCTAGGGGTTCCAGTTCTCCGACAAGAAACGTTAACATAGGGAAGAAGTCGCCTTCTGCGTC
CATTTCTCCTGTTAGAAACTTGGGAAAGAGGTCTCCAAAACTATCAACCGCTGCTAAGCTCAGAAGATCATTTACTCCTA
CGAGAAATGGCAGTAACTTGACCCGTAAGTCGTCCATGTCTCCAACAAGAGTCACGCTTCAAGCATTTATTTCTCCGGCA
AGAAATGGTAACTTTAATAAGAAGTCACTCAAAGCTTCGATATCTCCGACTAGGGTGAACAAGCCACAGAAGCTGTCAAC
GGCTGCAAAGCTCAGGAGATCATTTTCCCCATCGAGACTAGCGATGAGGCTGGTGTCTCCAATGAAGAGCAGGAAAAGTG
TGGCCAAGTGTGATGATCATGAGATGGTGAGTGGATTAAAACAGCGTCCGGTTATGGTTCCTAAGAGATTCTCGATGGGG
AGAATCTAG