Details for Capsella Locus Carubv10013575m

Position : scaf_3 ( 5`- 4922912 .. 4924442 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013575m

Protein [Map View]
MEQEDFYFPDTDLDLSFTSTVTDRTFASSSARSSLTLSFNDRLSTSSAVTTSSASSSTVNHRRHDPHWSAIKSAKLLSSD
GNIHLRHLKLIRHLGTGNLGRVFLCNLRDSSARFALKVIDRNCLTTEKKLSQVETEAEILSLLDHPFLPTLYARIDESHY
TCLLIDYAPNGDLHSLLRKQPGNCLPNQAVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLSDFDLCFKSDV
VPTFKSRRYRRTSSSPSLRRRRSGCFSVATEEKYEREEMVAEFAAEPVTAFSRSCVGTHEYLAPELVSGNGHGSGVDWWA
FGIFLYELLYGTTPFKGESKEQTLRNIVSTTKTASFHVDGDDSEEAKDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGI
KWPLIRHYKPPEEVRGLVIKKSTTRAHAGHVTAVSPRRRKSFLWRALSYLLRGKSSSGGSKNQSNSNYYHYVGKSYVSRK
RV*

DNA
ATGGAACAAGAAGATTTCTACTTCCCTGACACCGATCTTGATCTCAGCTTCACATCCACTGTCACAGACCGTACATTCGC
CTCCTCAAGCGCTCGTTCCAGCTTAACCTTAAGCTTCAACGACAGACTCTCCACTTCCTCCGCCGTTACAACCTCCTCGG
CCTCCTCCTCCACCGTCAACCACCGTCGTCATGATCCTCATTGGTCAGCAATCAAATCTGCCAAACTTCTCTCCTCCGAC
GGAAACATCCACCTACGTCACTTGAAACTCATACGCCACCTTGGAACCGGAAACCTAGGCCGAGTCTTCCTCTGTAACCT
CCGTGACTCTTCCGCGAGATTCGCCTTAAAAGTCATCGATCGTAACTGTCTCACGACGGAGAAGAAGCTATCTCAGGTTG
AAACGGAGGCAGAGATCCTCTCCTTGCTTGACCACCCTTTCCTCCCTACGCTCTACGCTCGTATCGACGAGTCTCACTAC
ACGTGTCTCCTCATCGATTATGCACCAAACGGAGACTTACATTCCTTGTTACGCAAGCAACCTGGTAACTGTTTACCGAA
TCAGGCGGTTAGGTTCTTCGCCGCCGAAGTTCTCGTCGCCTTAGAATATCTCCACGCAATGGGGATCGTCTACCGTGATC
TCAAACCTGAAAACGTTTTGCTCCGTGAAGACGGACACGTCATGTTGTCAGATTTTGATCTCTGTTTTAAATCCGACGTC
GTTCCTACTTTTAAATCTCGCCGGTACAGGAGAACTTCTTCATCTCCGTCTCTTCGTCGGAGAAGGAGCGGCTGCTTCTC
CGTAGCGACAGAAGAAAAGTACGAGAGGGAAGAGATGGTGGCTGAGTTCGCGGCGGAGCCAGTGACGGCGTTTTCAAGGT
CCTGCGTTGGAACACATGAGTACCTTGCACCGGAGCTAGTCTCCGGCAACGGACACGGAAGCGGAGTAGACTGGTGGGCG
TTTGGAATATTCCTTTACGAGTTGTTGTACGGAACGACGCCGTTTAAAGGAGAGAGCAAAGAGCAAACCCTGCGCAATAT
AGTATCGACCACCAAGACCGCGAGTTTCCACGTGGACGGTGACGATTCGGAGGAAGCGAAGGACTTGATTGAGAAGCTTT
TGGTGAAAGACCCGAGGAAAAGGCTAGGATGCGCCAGGGGTGCGCAAGATATCAAACGTCATCCGTTTTTCGATGGGATC
AAGTGGCCGTTGATTAGGCATTACAAGCCACCGGAGGAAGTTAGAGGTCTTGTGATTAAGAAGTCCACGACGAGAGCACA
TGCTGGTCACGTGACCGCCGTTTCACCACGACGGAGGAAGTCGTTTCTGTGGAGGGCCTTGTCTTATTTACTGCGCGGTA
AAAGCTCTAGTGGTGGGAGTAAAAACCAGAGCAATAGTAATTACTATCATTATGTGGGCAAAAGCTACGTGAGTCGTAAA
CGCGTTTAA