Details for Capsella Locus Carubv10013574m

Position : scaf_3 ( 5`- 939657 .. 941639 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013574m

Protein [Map View]
MPTPTSNGHASRLQIQEPITMSPSSSSSPIAFKEQQGRPPPAAHQTIAGKLFRNLFKGLLFSQLTLISLLVIVLTIRGLI
SASSHHFHPKKWYPPLLASVAVSGVASLAWQCIFIYNPSRAVRATFWLSPILTCSVGILLVLIGSAVDAVVGSAFVLFAI
TQSLYGCWITTRFEYTDKLLSLATAFPPARTREVVCLSITFSLVYSGFLVTGIGGATSTRTSVDLLFISVILISLSWTMQ
VLKNFQQVAISRARYVNFAHGEEMDAWDAFRITMKHLVGSICIGSTLVPIIVFIRGSIRSVNLMSGSSDEVMYSGADCFS
TIANKLITLGNRWGFVHVGTYDKGFVEASSDTWKKFRSTSGLEKLIDSDLTSSLCFLSAVSVGAVSSLTAGIWMLLTHKD
YALEVTLYAFIIGYFVGRVGLAWLQACVLAYYVAYSEDPQSMRFDGTIPNRIQRLQMLSAHRDNREHEVGREIEEDSTRY
NNC*

DNA
ATGCCTACACCTACAAGCAACGGCCATGCCTCTCGCTTGCAGATTCAAGAACCAATAACAATGTCTCCTTCTTCTTCTTC
TTCTCCAATCGCCTTCAAGGAACAACAGGGAAGACCACCTCCCGCAGCACATCAAACAATAGCCGGAAAACTCTTTAGAA
ACCTCTTCAAGGGTCTTCTCTTCTCACAACTAACCTTAATCTCGCTTTTGGTGATCGTTCTCACCATTCGCGGTCTCATC
TCAGCAAGTTCACACCATTTCCACCCCAAGAAATGGTACCCTCCTTTACTAGCCTCTGTTGCTGTCTCAGGAGTTGCATC
TTTAGCCTGGCAGTGCATCTTTATCTACAATCCATCTAGAGCAGTCAGAGCAACGTTCTGGCTTAGCCCAATACTCACCT
GCTCGGTAGGGATCTTGCTTGTTCTTATTGGCTCGGCAGTAGATGCAGTGGTTGGTTCAGCTTTTGTGCTTTTTGCCATC
ACTCAGTCTCTGTATGGTTGCTGGATCACTACCAGGTTTGAATACACAGATAAGTTATTATCACTTGCTACAGCATTCCC
ACCTGCAAGAACCAGAGAAGTAGTCTGTTTATCAATCACTTTTAGCTTAGTTTACTCTGGCTTCTTGGTGACTGGAATTG
GGGGAGCAACTTCCACTAGAACAAGTGTGGATCTATTGTTCATATCCGTGATCTTGATAAGCTTATCATGGACGATGCAA
GTTCTCAAGAATTTTCAACAAGTAGCGATTTCACGGGCGAGATATGTAAACTTTGCTCATGGAGAAGAGATGGATGCTTG
GGATGCTTTTCGCATCACTATGAAACACTTGGTTGGGAGCATCTGCATTGGCTCGACGCTTGTTCCAATCATTGTATTCA
TCAGAGGATCCATCAGAAGCGTTAACCTTATGTCAGGGAGCAGCGATGAGGTCATGTATTCTGGTGCTGATTGCTTCTCT
ACCATTGCCAACAAACTCATTACACTTGGAAACAGATGGGGCTTTGTACATGTGGGAACTTATGATAAAGGATTCGTGGA
GGCTTCTAGTGATACCTGGAAGAAGTTCAGAAGTACAAGTGGGCTAGAGAAACTGATTGATTCGGATCTGACAAGCTCCT
TGTGCTTCCTCAGTGCGGTTTCTGTTGGAGCTGTCTCTTCATTGACTGCTGGGATATGGATGTTGTTAACTCACAAGGAC
TATGCCTTGGAAGTGACTCTCTATGCTTTTATAATTGGATATTTCGTGGGAAGGGTAGGTTTGGCGTGGCTACAGGCATG
TGTGTTGGCTTACTATGTAGCTTATTCTGAAGATCCTCAGAGCATGCGGTTTGACGGTACAATTCCGAATCGTATTCAGC
GTCTTCAGATGTTAAGTGCCCATCGTGATAACAGGGAGCATGAGGTTGGTAGGGAGATTGAAGAAGATAGTACTCGTTAT
AACAATTGTTAG