Details for Capsella Locus Carubv10013573m

Position : scaf_3 ( 5`- 3020723 .. 3023661 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013573m

Protein [Map View]
MMDGRDDKAREEEKHESREDNQRDVESAEIAEEELSPGRDLWRRGLVLDLPSRTPEDTRDDLLRRNASLTSSPVAKRVNF
SPMSSPRIGQRGASLSPSSSSPRNKPNSLKNLIPKLSFKNRNSNNNNVDVEKAADLSFVSSPSSGNGRDRSTWNLATILT
PRLKKTESLPVTPIAHSNPESMHGRYVVDPVTSTKKGPPLPIHRSRSVPAFNKDGSLRQAGVFRVIPTPNMTPTRNSITL
NDVNVDGAEDVPEEEAVCRICLVELGEDSEAFKMECMCRGELALAHKECTIKWFTIKGNRTCDVCKQEVQNLPVTLLRMQ
NSQGNRGAADTEASHYSVWQDVPILVIVSMLAYFCFLEQLLLTKMKSGAIAISLPFSCVLGLLASMTSTTMVKKSYVWIY
ATTQFGLVVFFSHIFFTLVRMQPVVSILLATLVGFGLTMSATTGLVEFSKWRRRHRTGELPNSSQMDQPPVETIDESVSG
SRN*

DNA
ATGATGGATGGTAGAGATGATAAAGCTCGGGAAGAAGAAAAACATGAGTCTCGCGAAGATAACCAAAGGGATGTTGAGTC
TGCTGAGATAGCAGAAGAAGAGCTATCACCAGGTCGAGACCTATGGAGGCGAGGCCTTGTGCTAGATTTACCATCAAGAA
CACCTGAAGATACAAGAGATGATCTACTAAGACGAAATGCATCTTTAACATCAAGTCCTGTTGCCAAAAGAGTCAACTTC
TCTCCAATGTCAAGCCCTCGAATTGGGCAACGTGGTGCATCCCTGAGTCCTTCTTCTTCCTCTCCAAGAAACAAGCCTAA
TAGCCTGAAGAATCTAATCCCCAAGTTAAGCTTCAAGAACCGGAACAGCAATAACAATAATGTAGATGTCGAGAAAGCTG
CAGATTTGTCCTTTGTGTCCTCCCCTTCTTCAGGAAATGGTAGAGACAGGTCCACATGGAATCTAGCTACTATTTTAACT
CCAAGATTGAAGAAAACTGAGTCCTTGCCTGTAACTCCTATAGCTCACTCAAATCCTGAGTCCATGCACGGGAGATATGT
TGTTGATCCAGTTACTTCCACGAAAAAAGGGCCTCCATTGCCTATTCATCGTTCACGCTCTGTCCCTGCTTTCAATAAAG
ATGGAAGTCTAAGGCAAGCAGGTGTTTTCCGTGTAATTCCAACTCCAAACATGACGCCAACCAGAAATTCTATTACACTT
AACGACGTGAATGTTGATGGCGCTGAAGATGTTCCTGAAGAAGAAGCTGTGTGTAGAATCTGCCTGGTCGAATTGGGAGA
AGATTCAGAAGCCTTCAAGATGGAATGTATGTGTAGAGGCGAACTAGCTCTTGCCCACAAAGAATGTACAATCAAATGGT
TCACCATTAAAGGAAACAGAACATGCGATGTGTGCAAGCAAGAGGTTCAGAATCTCCCTGTCACCCTTCTTCGCATGCAG
AATTCTCAGGGTAATCGTGGAGCTGCAGATACCGAGGCTTCACACTACAGTGTATGGCAGGATGTTCCAATTCTTGTCAT
TGTAAGTATGCTTGCATACTTCTGTTTCCTCGAGCAGCTTCTGCTTACGAAAATGAAATCCGGTGCAATTGCAATTTCTT
TACCATTCTCCTGCGTTCTTGGTCTTCTTGCGTCGATGACTTCAACAACAATGGTGAAGAAGAGTTATGTCTGGATTTAC
GCCACAACTCAGTTCGGTCTTGTTGTTTTTTTCTCCCACATATTCTTTACGTTGGTTCGCATGCAACCGGTTGTGTCCAT
TCTCTTAGCCACATTGGTTGGGTTTGGACTCACGATGAGCGCAACTACAGGTCTAGTGGAGTTTTCGAAATGGAGGAGAA
GGCATAGGACAGGTGAACTTCCAAACAGTAGTCAGATGGATCAACCACCAGTTGAGACAATAGATGAGAGCGTGTCTGGA
TCAAGAAACTGA