Details for Capsella Locus Carubv10013569m

Position : scaf_3 ( 5`- 7362416 .. 7366895 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013569m

Protein [Map View]
MVSSTKLKSVDFYRKIPRDLTEASLSGAGLSIVAALFMVFLFGMELSSYLEVNTTTSVIVDKSTDGDFLRIDFNISFPAL
SCEFASVDVSDVLGTNRLNITKTIRKFPIDPHLRSTGAEFHSGHTLHHINHGEETKEEFPDGAIPLTSGSFESLSHHFPI
LVVNFNAPWCYWSNRLKPSWEKAANIIKQKYDPETDGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHH
EHESYYGDRDTKSIVKMVDELVAPIHPETHKVALDGKSNDTVKHLKKAPVTGGCRVEGYVRVKKVPGNLVISAHSGAHSF
DSSQMNMSHVVSHLSFGRMISPRLLTDMKRLLPYLGQSHDRLDGKAFINQHEFGANVTIEHYLQIVKTEVITRRSGLEQA
VIEEYEYTAHSSVAQTYYLPVAKFHFELSPMQILITEDPKSFSHFITNLCAIIGGVFTVAGILDSIFHNTIRLIKKVELG
KNI*

DNA
ATGGTTTCCTCCACCAAACTCAAATCCGTTGATTTCTACAGGAAAATCCCGAGAGATTTGACGGAGGCATCTCTATCAGG
CGCTGGGCTATCCATTGTAGCTGCTCTCTTCATGGTCTTCTTGTTTGGAATGGAGCTGAGTAGTTATTTGGAAGTCAACA
CTACCACATCTGTTATAGTTGACAAGAGCACTGATGGGGACTTCTTACGCATTGATTTCAACATCAGTTTTCCTGCACTT
TCATGTGAATTTGCGTCTGTTGATGTGAGTGACGTGTTGGGAACTAATAGGCTGAATATAACAAAGACAATTCGCAAGTT
TCCAATTGATCCGCATTTAAGGTCCACTGGCGCAGAATTCCACTCTGGCCATACATTACATCACATCAACCATGGAGAAG
AAACTAAGGAAGAGTTCCCTGATGGGGCTATACCATTAACCAGTGGTAGTTTTGAATCACTTTCACATCACTTTCCAATA
TTGGTGGTTAACTTTAATGCACCATGGTGCTACTGGAGTAATCGCCTGAAACCTTCATGGGAGAAAGCAGCTAATATAAT
AAAGCAAAAATATGATCCTGAGACTGATGGCCGTGTTCTTCTAGGAAACGTTGATTGCACGGAAGAACCTGCGCTGTGTA
AGAGGAATCACATACAAGGCTATCCATCTATTCGTATTTTCCGCAAAGGCAGTGACCTTAGAGAGGACCATGGACACCAC
GAACATGAATCTTACTATGGAGATCGGGACACAAAGAGTATAGTTAAGATGGTGGACGAATTGGTCGCACCTATCCACCC
GGAGACTCACAAGGTAGCTTTAGATGGTAAATCCAATGATACCGTAAAACATCTTAAAAAGGCACCAGTTACAGGAGGTT
GTAGAGTTGAAGGTTATGTACGTGTAAAGAAGGTTCCAGGAAACCTCGTTATCTCAGCTCATTCAGGAGCTCATTCATTC
GATTCTTCTCAAATGAACATGTCGCATGTTGTTTCCCATCTTTCATTTGGGAGGATGATTTCTCCTAGGTTGCTGACTGA
TATGAAGCGGTTGCTGCCATATCTAGGCCAAAGCCATGACAGGCTGGATGGAAAGGCATTCATAAATCAACATGAGTTTG
GTGCCAATGTTACTATTGAACACTACCTTCAAATAGTCAAAACAGAGGTCATTACAAGAAGATCAGGTCTAGAGCAAGCA
GTAATAGAGGAATATGAATACACTGCTCACAGCAGCGTGGCTCAGACTTACTACTTACCCGTGGCAAAGTTTCACTTTGA
GCTCTCTCCCATGCAGATCTTGATAACCGAAGACCCAAAGTCCTTTTCTCACTTCATCACAAATCTATGCGCCATTATTG
GTGGTGTTTTCACGGTTGCGGGAATACTAGATTCGATTTTCCACAATACAATAAGACTAATAAAAAAGGTCGAACTCGGC
AAAAACATTTGA