Details for Capsella Locus Carubv10013568m

Position : scaf_3 ( 5`- 6740798 .. 6745065 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013568m

Protein [Map View]
MFPTIKGYDHGDEQKLRSCNKIPELFINLLTCVDSDERTCTKNDDVYILSLVLPHQENRFWLSSAASCFPSSSITEKMVS
DLDIVTRLREILGSSDLDTATPATVRRQLEADFGVDFTDKKAFIRDQIDAFLESNGSVEEESLKAEEEEEEDINAADEIK
AVIEDGNGSESEEEKEERPVKAKKRGGGFTKVCQLSPQLEKLVGTSQLARTEVVKKIWAYIKGKGLQDPKDRRKIVCDEL
LHSLFRVKTINMFQMNKALTKHIWPLGDGDGCANNVKEEDEDEDDDEASEGTDKKGEQNEEVEENKEEENEDEEVRSLRK
RKRKKPAKSVEKPKRKGGGGFAKVCSLSPELQAFTGVTELARTEVVKMLWKYIKENNLQDPNDGRTIICDESLLSLFPVE
SINMFQMNKLLTKHIWPLDNNAVSPNSPKNGKQKMESDGDTDSEEPNEKDKKLKTEDLPSLPLSDALVKFLGNGESSLSR
ADS*

DNA
ATGTTCCCAACAATAAAAGGTTACGATCATGGTGACGAACAAAAGTTACGATCATGCAACAAAATTCCAGAACTGTTTAT
AAACCTTTTAACATGCGTTGACAGTGATGAACGAACATGCACCAAAAACGACGACGTTTACATCCTTTCTCTAGTTCTCC
CACATCAAGAGAATCGGTTTTGGCTTTCATCAGCCGCTTCGTGTTTTCCTTCTTCTTCAATAACGGAAAAAATGGTTTCC
GACTTGGACATCGTGACCCGTCTCCGTGAGATTCTCGGTAGCTCCGACCTTGACACGGCGACTCCGGCTACCGTCCGTCG
TCAGCTGGAGGCGGATTTCGGTGTCGACTTTACTGATAAGAAGGCTTTCATTAGGGATCAAATCGATGCTTTTCTCGAGA
GCAATGGCTCTGTAGAAGAAGAGAGCCTTAAGGCAGAAGAAGAAGAAGAAGAAGACATTAATGCCGCCGACGAAATCAAG
GCGGTAATTGAAGACGGAAATGGAAGTGAAAGTGAGGAAGAGAAGGAGGAACGGCCAGTAAAGGCCAAGAAACGAGGAGG
TGGCTTTACTAAAGTATGCCAGCTCTCTCCACAACTTGAGAAGCTTGTTGGAACATCTCAGTTAGCTCGAACCGAGGTTG
TGAAGAAAATATGGGCCTATATCAAAGGGAAGGGTTTGCAAGACCCAAAGGACAGGAGGAAGATAGTGTGTGATGAGTTG
CTTCATTCCTTGTTCCGTGTCAAGACCATTAATATGTTTCAAATGAACAAGGCATTAACGAAGCATATTTGGCCCTTAGG
CGATGGAGATGGGTGTGCTAACAATGTCAAAGAAGAAGATGAAGATGAAGATGACGATGAGGCATCAGAGGGAACTGACA
AGAAAGGGGAGCAAAACGAAGAAGTGGAAGAGAACAAGGAAGAAGAAAATGAAGATGAGGAAGTTAGGAGTTTGCGGAAA
CGCAAGAGAAAAAAGCCAGCCAAGTCAGTAGAGAAGCCCAAGAGAAAAGGAGGAGGTGGCTTCGCTAAAGTTTGCAGCCT
CTCGCCGGAGCTTCAGGCGTTTACTGGGGTGACAGAATTAGCCAGGACAGAGGTGGTGAAAATGCTTTGGAAGTATATAA
AAGAGAACAATTTGCAAGATCCGAATGATGGACGCACAATAATATGTGACGAGTCATTGCTATCTCTGTTCCCTGTCGAG
TCTATCAATATGTTTCAAATGAATAAACTACTAACAAAGCACATATGGCCTTTAGATAATAATGCAGTTAGCCCTAACTC
TCCAAAGAACGGAAAGCAAAAAATGGAATCAGATGGAGACACAGATAGTGAGGAACCGAACGAGAAAGATAAAAAACTGA
AGACAGAAGACCTTCCTTCCCTTCCACTTTCAGATGCTCTTGTCAAGTTCTTGGGCAATGGAGAAAGCTCTCTGTCGAGG
GCGGATAGTTGA