Details for Capsella Locus Carubv10013567m

Position : scaf_3 ( 5`- 2192040 .. 2194715 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013567m

Protein [Map View]
MIARRIWRSHRFLRPFSSSSVCPPPPFRVPEFHPQSSSSPASRPFFLHPLTLMKWSGQSRSWFSNEAMAIDSHAGLIDVP
LAQTGEGIAECELLKWFVQEGDPVEEFQPLCEVQSDKATIEITSRFKGKVALISHSPGDIIKVGETLVRLAVEDAQDAFL
VTSDRSEIVNPGCLKQNIDNVVGALSTPAVRNLAKDLGIDINVIAGTGKDGRVLKEDVLRFGDQKGFATDSVSTEHAVVG
GDSVSTTASNFEDKTVPLRGFNRAMVKTMTMATTVPHFHFVEEINCDALVELKQFFKENNTDSTIKHTFLPTLIKSLSMA
LAKYPIVNSCFNAESVEIILKGSHNIGVAMATEHGLVVPNIKNVQSLSLLEITKELSRLQHLATNNKLNPEDVTGGTITL
SNIGAIGGKFGSPLLNLPEVAIIALGRIEKVPKFSEEGTVYPASIMMVNIAADHRVLDGATVARFCCQWKEYIEKPELLM
LQMR*

DNA
ATGATCGCGCGACGGATCTGGCGGAGTCATCGGTTTCTCCGCCCATTCAGCTCGTCATCTGTTTGCCCTCCTCCGCCTTT
TCGGGTACCTGAGTTTCATCCTCAGTCGTCTTCTTCTCCGGCGTCGCGCCCATTCTTTCTTCACCCTCTCACTTTGATGA
AATGGTCTGGACAAAGTAGAAGCTGGTTTTCAAACGAAGCCATGGCCATAGATTCTCATGCAGGCCTAATTGATGTGCCT
CTAGCACAAACTGGGGAAGGTATTGCTGAATGCGAGCTTCTCAAGTGGTTCGTGCAAGAGGGAGATCCTGTTGAAGAGTT
TCAGCCATTATGTGAAGTTCAGAGCGATAAAGCAACAATAGAGATAACAAGTCGTTTTAAGGGGAAAGTGGCTCTCATCT
CACATTCTCCAGGTGACATTATCAAGGTTGGAGAGACCCTGGTCAGGCTGGCCGTTGAAGACGCACAGGATGCTTTTCTA
GTAACCTCTGATCGTTCAGAAATTGTAAATCCGGGATGTTTAAAGCAGAACATAGACAATGTCGTTGGAGCTCTCTCAAC
TCCTGCTGTACGTAACCTTGCAAAAGACCTTGGCATAGATATCAATGTTATAGCTGGAACTGGTAAAGATGGGAGGGTTT
TGAAAGAGGATGTTCTTCGATTTGGTGACCAGAAAGGATTTGCAACAGATTCGGTTTCTACTGAGCATGCTGTTGTAGGA
GGAGACTCAGTTTCCACTACAGCGAGTAACTTTGAAGATAAAACAGTTCCTCTAAGGGGATTCAACCGAGCAATGGTCAA
GACAATGACTATGGCTACAACTGTACCGCATTTTCATTTCGTTGAAGAGATAAACTGTGACGCACTTGTGGAGCTCAAGC
AGTTCTTCAAAGAGAACAATACAGATTCCACCATCAAACACACTTTTCTTCCTACTTTAATCAAGTCACTGTCAATGGCT
CTAGCCAAATATCCCATAGTGAATAGTTGCTTCAACGCAGAATCTGTCGAGATCATTCTCAAAGGTTCACATAACATTGG
AGTTGCAATGGCCACTGAACATGGCCTTGTCGTTCCTAATATAAAGAATGTTCAGTCATTATCTCTGCTAGAGATAACTA
AAGAGCTATCGCGGTTACAGCATTTGGCGACAAACAACAAACTAAACCCCGAGGATGTAACTGGTGGAACCATAACTCTG
AGTAACATTGGAGCAATCGGCGGGAAATTCGGATCCCCTCTTCTAAACCTACCAGAAGTTGCAATCATCGCTCTTGGAAG
AATCGAGAAAGTTCCAAAATTCTCAGAAGAAGGAACTGTTTATCCTGCATCAATAATGATGGTTAACATAGCCGCAGATC
ACAGAGTCCTAGATGGAGCAACGGTAGCTCGGTTTTGCTGCCAGTGGAAAGAGTACATCGAGAAACCGGAGTTGCTAATG
CTTCAAATGAGATAG