Details for Capsella Locus Carubv10013566m

Position : scaf_3 ( 5`- 13561795 .. 13566806 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013566m

Protein [Map View]
MEASPMADLEMFLQDRCLSVLNLPEKGRSLFTTRDFRPGEVILSQKPYICVPNNTSSESRCDGCFKTNNLKRCSGCQVVW
YCGSSCQKSEWKLHRDECKALSRLDKEKRKFVTPTIRLMVKLYIKRNLQNEKVLPITTTDNYSLVDALVSHMSEIDEKQM
LLYAQMANLVNLILQFPTVDLREIAENFSKFSCNAHTICDSELRPQGIGLFPFVSIINHSCSPNAILVFEDQMAVVRAMD
NILKDSEITISYIETAGSTLTRQKSLREQYLFHCHCARCNNVGKPDDIEESAILEGYRCANEKCTDFLLRDPEEKGFVCQ
KCLLLRSKEEVKKIASDIKRVSEKALASPSEEDKQASIELHKTIEKLQFKLYHSFSITLMRTREKLLKMLMDVESWREAL
NYCRLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGETKEAVSSLTKAFDILRISHGTSTPFMKELSAKLEEARAEASYI
SSLH*

DNA
ATGGAAGCTTCTCCTATGGCGGATTTGGAGATGTTTCTACAAGATCGGTGCTTAAGCGTTTTGAATCTCCCAGAGAAAGG
CCGCTCTCTATTCACTACCAGAGACTTCCGTCCAGGCGAAGTGATTCTAAGCCAAAAGCCATATATTTGTGTTCCGAATA
ATACCTCCTCGGAATCAAGGTGCGATGGATGTTTCAAGACCAATAACCTAAAGAGATGCTCTGGTTGTCAAGTCGTTTGG
TACTGTGGAAGCTCTTGCCAGAAGTCAGAGTGGAAGTTGCATCGTGATGAATGCAAAGCTCTCTCTAGGCTTGATAAGGA
GAAACGGAAGTTCGTTACTCCTACGATACGTCTGATGGTCAAACTTTACATCAAGAGGAATTTGCAGAATGAAAAGGTCC
TGCCAATTACGACAACAGACAATTATAGTTTGGTGGATGCTTTGGTGTCCCACATGTCTGAGATTGATGAAAAGCAGATG
TTGTTGTATGCACAGATGGCTAATCTTGTGAACTTGATTCTTCAATTTCCTACTGTTGACCTAAGAGAGATCGCCGAGAA
CTTTTCAAAGTTTTCATGCAATGCTCATACCATTTGTGATAGCGAATTGAGACCTCAAGGGATAGGATTGTTTCCCTTTG
TTTCCATTATAAATCACAGTTGCTCTCCCAATGCGATTTTAGTGTTTGAGGATCAGATGGCTGTTGTTCGTGCAATGGAT
AACATATTAAAGGATTCAGAGATAACTATCAGCTATATCGAAACCGCTGGAAGCACTCTGACTCGGCAGAAGTCTCTGAG
AGAACAATATCTTTTCCACTGTCATTGTGCCCGTTGCAATAACGTTGGAAAACCTGATGATATTGAAGAAAGTGCAATAT
TGGAAGGCTATCGGTGTGCCAATGAGAAATGCACTGATTTCTTACTCCGTGATCCTGAAGAAAAAGGCTTTGTTTGCCAG
AAATGTTTGCTTCTTAGGAGCAAGGAAGAGGTTAAAAAGATAGCAAGTGATATCAAAAGAGTTTCAGAAAAGGCACTTGC
ATCTCCTTCCGAAGAAGATAAACAAGCCTCTATTGAACTACATAAGACAATTGAGAAACTACAATTTAAGCTTTACCATT
CGTTCTCCATCACTTTAATGAGAACCCGTGAGAAACTTCTTAAGATGCTAATGGATGTAGAAAGCTGGAGAGAAGCTTTG
AATTATTGCAGACTAATAGTCCCTGTTTACCAAAGAGTATATCCAGCAACTCATCCTTTGATAGGACTGCAGTTCTATAC
CCAGGGAAAACTCGAATGGTTGCTGGGGGAAACGAAAGAGGCGGTGAGTTCACTGACCAAGGCATTTGACATTCTGCGGA
TCAGCCACGGAACAAGCACACCTTTCATGAAAGAGCTCTCGGCAAAGTTGGAGGAAGCTCGTGCGGAAGCTTCTTATATA
AGCAGCTTGCATTGA