Details for Capsella Locus Carubv10013559m

Position : scaf_3 ( 5`- 9257979 .. 9262923 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013559m

Protein [Map View]
MRYQMISNVCFRQQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSQNLQLDAKHMKNRSILLVRPLLDLW
KEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGNLHSGNFKSELQAVISECRRTRLYVDKVCTDLINQTVTVTDKGY
AILDLERLNPTEVKDICLSKYLAAVLQFISQRQRPIRGNTSKLLLNYIRAIPCRTSLTAAGCYLSPAPGSKGTKIIVSCS
ADCPLPSKAELLNICCNETHKNPTSDDLGKIIANAKSFPYHAAPSRLLEVQFVDVASESLLSKARELSLLSESTYTTIGL
LQRDETSRFITKTEEKSVDESEHETNIASSSDKVHLWPGQSLYFMNRFLIRWNLSDHQCDEAGCGNCPVRTATSVEVRHM
VESDWLYLAELSRSSNRNHSTTSSQKALRSLKFIPAAARRSLPVLANHCGLLLSSPAIDFSYCSCLEASVVFLPRVPLGG
GYSSFL*

DNA
ATGAGGTATCAGATGATTTCGAATGTATGCTTTCGACAACAGATTGAGGTCTTGCTTATAGCTCATCATGCAGATGACCA
GGCTGAGTTATTCATTCTTAGGTTATCTCGTAGTAGCGGTGTACTTGGGCTTGCAGGGACAGCGTTTGCTTCAGAGATTT
TCTCCCAAAATTTGCAGTTAGATGCAAAACATATGAAGAATCGGTCTATTCTCTTAGTGCGTCCACTGCTGGATTTATGG
AAAGAAGACATGTACAAGATATGTCAATGGGGTAGACAAGATTGGGTTGAGGATCCGACTAATCGTAGTCAGTTATTTGT
TCGGAATAGGATTCGAACATCAATAGGAAATCTACATTCAGGTAACTTCAAATCAGAGCTGCAAGCAGTCATTTCTGAAT
GCAGGAGAACACGTTTATATGTCGATAAAGTTTGTACGGACTTAATAAATCAGACTGTAACAGTGACAGATAAAGGGTAT
GCTATTCTTGATCTAGAGAGACTAAACCCTACAGAAGTTAAAGACATTTGCCTCTCAAAGTATCTCGCTGCGGTCCTGCA
GTTTATCTCTCAACGGCAAAGACCAATCAGAGGAAACACTTCAAAGTTGCTTTTGAACTACATCCGTGCAATTCCATGCA
GGACATCTCTAACAGCTGCTGGTTGCTACCTTAGTCCGGCTCCAGGGTCGAAAGGGACAAAAATTATAGTCTCCTGTTCC
GCTGACTGTCCTTTACCGTCGAAGGCAGAACTCTTGAACATTTGCTGCAATGAAACTCACAAAAATCCTACATCTGATGA
CCTTGGAAAAATTATAGCAAACGCAAAATCTTTTCCTTACCATGCCGCTCCAAGCAGATTGTTAGAAGTCCAGTTTGTGG
ATGTTGCATCTGAATCCTTATTGAGTAAAGCTAGAGAGCTCAGTCTTCTCAGCGAATCAACCTATACAACCATCGGTCTT
CTGCAGAGGGATGAAACCAGTAGGTTCATAACTAAAACAGAAGAGAAATCAGTGGATGAATCAGAGCATGAAACTAACAT
TGCATCTTCCTCTGATAAAGTACATCTTTGGCCAGGGCAAAGTCTCTACTTCATGAACCGCTTTCTCATCAGATGGAACT
TGAGTGACCACCAATGTGATGAAGCGGGCTGCGGAAATTGTCCAGTGAGGACTGCTACATCAGTGGAGGTTCGGCATATG
GTTGAATCTGACTGGCTATATCTAGCAGAGCTTTCAAGATCCTCGAACAGAAATCATTCTACGACATCCTCACAAAAAGC
TCTTAGGTCCTTGAAGTTTATCCCAGCCGCTGCAAGACGAAGCCTACCTGTCTTAGCCAATCACTGTGGATTACTACTCA
GCTCTCCCGCTATTGACTTCAGTTATTGTTCATGTCTAGAGGCTTCTGTTGTGTTTCTTCCAAGAGTACCACTCGGAGGC
GGTTATAGCTCATTTCTTTAG