Details for Capsella Locus Carubv10013558m

Position : scaf_3 ( 5`- 3357431 .. 3362474 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013558m

Protein [Map View]
MLTMEKEFDSKLVIQGNSSSNGETISRSKSFAFKAPQENFTSHDFELGKIYGVGSYSKVVRAKKKDNGTVYALKIMDKKF
ITKENKTAYVKLERIVLDQLEHPGIVKLFFTFQDTQSLFMALESCEGGELFDQITRKGRLSEDEARFYSAEVVDALEYIH
NMGLIHRDIKPENLLLSSDGHIKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALG
CTLYQMLSGTSPFKDASEWLIFQRIIARDIKFPNHFSEAARDLIDRLLDTDPSRRPGAGSEGYASLKRHPFFKGVDWKNL
RSQTPPKLAPDPASQTASPERDGSPWNPTHVGDASVLQNDGHGGHSESSGSITRLASIDSFDSRWQQFLEQGESVLMISA
VKKLQKITSKKVQLILTNKPRLIYVDPSKLLVKGNIIWSDNSNDLNVQVSSPSHFKICTPKKVLSFEDAKQRALQWKKAI
ETLQNR*

DNA
ATGTTGACAATGGAGAAGGAATTTGATTCAAAGCTTGTTATTCAAGGGAATTCATCATCAAATGGTGAAACTATTTCCAG
AAGCAAGAGCTTCGCATTTAAGGCTCCTCAGGAGAATTTCACCAGCCATGATTTCGAGCTCGGCAAGATCTATGGTGTTG
GCTCTTATTCAAAGGTTGTTAGAGCAAAGAAGAAGGATAATGGAACTGTGTATGCCTTGAAGATCATGGACAAAAAGTTC
ATCACCAAGGAGAATAAAACAGCTTATGTCAAACTGGAGAGGATTGTTCTTGATCAACTCGAGCATCCCGGGATTGTGAA
ACTTTTCTTTACATTTCAAGATACACAATCACTATTCATGGCGCTTGAATCTTGCGAGGGTGGGGAACTTTTCGACCAAA
TCACCAGAAAAGGTCGTCTATCAGAGGATGAAGCTCGGTTTTACAGTGCAGAAGTTGTGGATGCTCTCGAGTATATACAT
AATATGGGACTGATACATCGAGATATCAAGCCGGAGAATTTGTTGCTAAGTTCAGATGGACACATTAAGATTGCTGATTT
TGGCAGTGTAAAGCCAATGCAAGACAGCCAAATAACAGTACTTCCTAATGCAGCTTCCGATGATAAGGCGTGCACTTTTG
TTGGAACGGCTGCATATGTTCCTCCTGAAGTTCTAAACTCCTCTCCAGCAACTTTCGGAAATGATCTCTGGGCGCTTGGC
TGCACTCTGTACCAAATGCTTTCAGGAACTTCTCCATTCAAGGATGCTAGTGAATGGCTGATTTTCCAAAGAATTATTGC
GAGAGATATAAAGTTTCCAAATCATTTCTCAGAAGCAGCAAGAGACCTCATCGACCGATTGCTAGATACAGATCCTAGTA
GAAGACCAGGAGCTGGATCAGAAGGCTATGCTTCTCTCAAGAGACATCCTTTCTTCAAGGGGGTTGACTGGAAAAATCTA
AGGTCACAAACTCCTCCAAAACTAGCTCCAGATCCTGCGTCCCAGACAGCATCTCCAGAGAGGGATGGTTCCCCATGGAA
CCCAACACATGTTGGAGACGCTTCAGTCTTGCAGAACGATGGACATGGCGGACACTCTGAATCCTCAGGTTCCATAACTC
GGCTTGCCTCCATAGACTCTTTTGATTCGAGATGGCAACAGTTTCTAGAACAGGGAGAATCAGTTCTAATGATATCAGCA
GTGAAGAAGCTACAGAAAATCACAAGTAAGAAGGTGCAACTAATACTCACCAACAAACCGAGACTGATATACGTTGACCC
ATCAAAGCTTTTAGTAAAAGGGAACATAATCTGGTCTGATAACTCCAACGACCTCAACGTTCAAGTCTCAAGTCCTTCAC
ATTTCAAGATTTGCACACCGAAGAAGGTTTTATCGTTTGAAGATGCGAAACAGAGAGCTTTGCAGTGGAAGAAGGCAATT
GAAACTCTTCAAAACCGTTGA