Details for Capsella Locus Carubv10013557m

Position : scaf_3 ( 5`- 495853 .. 498141 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013557m

Protein [Map View]
MAGQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESFVKSIQKPRVIIMLVK
AGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVAENGFLYLGMGVSGGEEGARNGPSMMPGGSYEAYKNIEDI
VLKVAAQVRDSGPCVTYIGKGGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLSNEELHSVFTDWNKGELESFLVEIT
ADIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTD
QTVDKKQLIDDVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRIKQAYDRNADLANLLV
DPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRERLPANLVQAQRDYFGAHTYERTDVEGSFHTEWFKI
ARQSKI*

DNA
ATGGCTGGTCAACCTACAAGAATAGGTCTTGCTGGACTGGCTGTGATGGGTCAGAACTTAGCTCTCAACATTGCTGAGAA
AGGCTTCCCAATCTCTGTTTACAACAGAACTACTTCCAAAGTTGATGAGACCGTCGAACGTGCCAAAAAGGAAGGCAACC
TTCCGCTTTATGGCTTCCACGACCCAGAGTCTTTTGTCAAATCCATTCAGAAGCCACGTGTTATCATCATGCTTGTTAAG
GCTGGTGCTCCTGTCGACCAGACCATCAAGACCCTCTCTGCTTATTTGGAGAAGGGTGATTGCATTGTGGATGGTGGTAA
TGAATGGTATGAGAACACTGAGAGGAGAGAAAAAGCCGTGGCCGAGAACGGTTTCCTCTACCTTGGAATGGGAGTTTCTG
GTGGTGAAGAAGGTGCTCGTAACGGCCCATCTATGATGCCTGGAGGCTCTTATGAAGCCTACAAGAATATCGAAGACATT
GTTCTCAAGGTTGCAGCTCAGGTTAGGGACAGCGGTCCCTGCGTGACTTACATTGGTAAGGGCGGGTCTGGAAACTTTGT
CAAAATGGTCCACAATGGGATAGAGTACGGTGATATGCAGCTGATCGCAGAAGCTTATGACGTCCTGAAATCTGTTGGTA
AATTATCGAACGAAGAGCTTCACAGTGTCTTCACTGACTGGAACAAAGGTGAGCTTGAGAGTTTCTTGGTAGAGATCACA
GCAGACATTTTCGGGATCAAGGACGATAAGGGAGATGGGCATTTGGTTGACAAGGTTTTGGACAAAACCGGCATGAAAGG
TACCGGAAAATGGACTGTGCAGCAAGCTGCTGAGCTATCTGTCCCTGCTCCCACCATTGAATCCTCTCTTGATGCGAGGT
TCCTCAGCGGGCTAAAGGATGAACGTGTGCAAGCAGCTAAAGTCTTCAAGGCAGGTGGGTTTGGTGATATCTTGACCGAT
CAAACTGTTGACAAGAAACAGCTCATCGATGACGTGAGGAAGGCTCTTTACGCATCCAAAATCTGCAGTTACGCACAAGG
CATGAACCTGATCCGTGCCAAGAGCATGGAAAAAGGGTGGGGGTTGAAGCTAGGTGAGTTAGCTAGAATCTGGAAAGGAG
GCTGCATCATCAGAGCTATCTTCTTAGACAGGATCAAGCAAGCTTATGACAGGAACGCAGACCTGGCTAACCTATTGGTG
GATCCTGAGTTTGCGAAAGAGATCATCGAGAGACAGTCTGCTTGGAGAAGAGTCGTTTGCTTAGCTATCAACTCGGGTAT
TAGCACGCCGGGAATGTCTGCGAGTCTCGCCTACTTTGATTCTTACAGGAGAGAGAGATTGCCAGCAAATCTTGTCCAGG
CACAGAGGGATTACTTTGGTGCTCATACATATGAGAGGACTGATGTGGAAGGATCATTCCACACCGAGTGGTTCAAGATT
GCAAGACAATCCAAGATCTGA