Details for Capsella Locus Carubv10013545m

Position : scaf_3 ( 5`- 4084592 .. 4087013 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013545m

Protein [Map View]
MGETLITTLSMENYHPSTLLSMDSGAFTHEESERETNRSLILTGPPDINLPLSSEASPSLLLWNEHCDILDVGLGPQLYE
PEAVVHVPKVAKKYNKRVDSAWGAWLFFSFYFKPVLDDKSKSKLTRDSNGLSGYDKSDLQLDSFLVQHDMENMYMWVFKE
KPENALGKMQLRSYMNGHSREGERPFPFSVDKGFVRSHRMQRKHYRGLSNPQCLHGIEVVHSPNLSVLNEDEKKKWTELT
GRDVNFAIPAEASDYGSWRNLPATEFEAERPLPMAKANGHTHLKKLNGTCLNLSTHSPDHAVDTVEVRPASSNKRKRDCL
ALGNCDDSSSSEKSLDMKIHAMELPWSNDFSGVMKNVYGPVTAAKTIYEDDKGFLIVMSLPFVDSGRVKVTWRNTPTHGI
VKISCVSTACEPFVKRHDRTFKLTDPTPEHCPLGEFVREVSLPNRIPDDAKLEAYRDETGTTLEVLVPKHRMGPEEHEVR
VCLRPFVLE*

DNA
ATGGGTGAGACTCTCATCACAACCCTGTCTATGGAGAACTATCACCCGTCGACACTTCTTTCCATGGATTCTGGTGCTTT
TACTCACGAAGAATCTGAGAGGGAGACAAACCGATCCCTCATACTTACCGGGCCGCCTGATATCAATCTTCCTCTCTCAT
CTGAAGCAAGTCCATCTCTGCTTCTGTGGAACGAGCACTGTGATATCTTAGACGTTGGACTCGGCCCTCAGCTATATGAG
CCTGAGGCTGTTGTTCATGTGCCTAAGGTTGCCAAGAAGTACAACAAACGTGTTGATAGTGCATGGGGTGCTTGGCTTTT
CTTCAGTTTCTACTTCAAACCTGTTTTGGATGACAAGTCCAAAAGTAAGTTAACGAGGGACAGCAATGGCTTGTCCGGTT
ACGATAAATCTGATTTGCAGCTCGACTCCTTCTTGGTTCAGCATGATATGGAGAATATGTACATGTGGGTGTTCAAGGAA
AAGCCTGAAAATGCCCTTGGCAAGATGCAGCTGCGCAGTTACATGAACGGACACTCACGCGAGGGTGAGCGTCCTTTCCC
TTTTAGTGTGGACAAAGGTTTTGTCCGCTCTCATAGGATGCAGAGGAAACATTACCGTGGTCTCTCTAACCCACAGTGCC
TCCATGGAATTGAAGTTGTTCATTCACCCAATCTTTCTGTACTCAACGAGGATGAAAAGAAGAAGTGGACAGAACTCACA
GGCCGAGACGTGAACTTTGCTATTCCAGCTGAAGCTAGTGATTACGGTTCATGGAGGAATCTCCCAGCCACTGAATTTGA
GGCTGAGCGTCCTCTTCCTATGGCTAAAGCTAACGGGCACACCCACCTGAAAAAACTGAACGGTACCTGCCTGAACCTGT
CAACACATTCCCCAGACCATGCAGTTGATACAGTGGAAGTTCGACCAGCGTCTAGCAATAAGCGCAAAAGGGATTGTCTT
GCTCTAGGGAACTGCGATGACTCGAGCTCAAGTGAGAAATCTCTGGACATGAAAATCCATGCAATGGAGCTGCCTTGGTC
GAATGATTTCAGTGGGGTGATGAAGAATGTGTACGGTCCAGTCACAGCTGCGAAAACAATATATGAAGACGACAAAGGGT
TCTTAATAGTTATGAGCCTGCCATTTGTTGATTCGGGAAGAGTGAAAGTGACATGGAGGAATACACCAACACATGGAATA
GTGAAGATATCATGTGTAAGCACAGCATGTGAGCCATTCGTGAAGAGACATGATAGAACATTTAAGCTAACAGATCCGAC
ACCAGAGCATTGCCCACTGGGGGAATTTGTCCGTGAAGTCTCTTTGCCGAACAGGATTCCAGATGACGCCAAGCTTGAAG
CTTACCGGGATGAAACCGGAACAACACTAGAGGTTTTAGTGCCCAAACACCGAATGGGACCAGAAGAGCATGAGGTTCGC
GTATGTCTCCGTCCGTTCGTGCTAGAGTGA