Details for Capsella Locus Carubv10013544m

Position : scaf_3 ( 5`- 7013611 .. 7015709 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013544m

Protein [Map View]
MDPCSFVRIIVGNLAVRFPSSSSPSSSSSGPSVSGITPSPPNCYCKIRFKNFPREIVSVPVLFRSESESDARSSSTTVAA
CFSLSKSQLEASLKKPKWSVLSVEAYSRGYSDADDAVTGASCGLASAGEKLLGRFEVSLDLKSAETKTCLAHNGWVALGS
KKGSGKSNRSKAGSDPELHVCVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLNSSSMMS
ELISTRSCISSLKSEKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGCTWKPWGRL
EAWREAGYSDTLGYRFDLFQDGIATAVSASSSISLKNGGSFVIDVTGGTTTTASTPTTSPQGSWDLGSGSSSGSRPASRP
GSGSGSDFGYLLPQHPSAQNRGFVMSATVEGVGKRSKPEVEIGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSDKLRKE
LRQQSQLGVV*

DNA
ATGGATCCGTGCTCTTTCGTACGGATCATCGTCGGCAACTTGGCCGTTCGGTTTCCCTCATCGTCGTCTCCTTCTTCTTC
TTCATCAGGACCTTCTGTTTCTGGAATCACTCCATCTCCTCCCAACTGTTACTGCAAAATCAGATTCAAGAATTTCCCCC
GTGAGATTGTTTCCGTTCCCGTTCTCTTCCGTTCCGAATCTGAATCCGACGCTCGTTCCTCTTCCACCACCGTCGCTGCT
TGCTTCAGTCTTAGCAAATCTCAGCTTGAAGCTTCTCTCAAGAAACCTAAGTGGAGCGTTCTCTCCGTCGAGGCTTACTC
CCGCGGTTACAGCGACGCTGACGACGCTGTTACCGGCGCCTCGTGTGGACTCGCTTCCGCGGGTGAGAAGTTGCTCGGTC
GATTTGAGGTCTCGCTTGATTTGAAATCGGCCGAGACTAAGACTTGTTTGGCTCACAACGGTTGGGTTGCTTTGGGTTCT
AAGAAAGGAAGTGGTAAATCCAATAGAAGTAAAGCTGGATCCGATCCGGAGCTCCACGTTTGTGTACGGGTCGAACCTGA
CCCGAGATTCGTGTTTCAGTTCGACGGCGAGCCTGAGTGTAGCCCTCAGGTATTTCAGGTCCAAGGAAACACTAAACAAG
CTGTGTTCACTTGCAAGTTCGGCTCTAGAAACTCTAACTCCGGTGATCGGAATCTTCTTAACAGTTCTTCGATGATGTCT
GAGTTAATCTCAACGAGAAGTTGTATATCGTCGTTGAAATCGGAAAAGGAACAACCGTCGAAAGAGAGAAAGGGATGGTC
CGTAACGGTCCATGATCTATCTGGTTCACCCGTCGCTATGGCCTCAATGGTCACACCTTTCGTACCATCTCCTGGTTCCA
ACCGTGTCACTCGATCCAGTCCTGGCGCGTGGCTCATTCTTAGACCCGACGGTTGCACATGGAAGCCATGGGGAAGGCTA
GAGGCATGGCGTGAAGCCGGTTACTCTGACACACTCGGTTACCGTTTTGACCTTTTCCAAGACGGTATCGCCACCGCCGT
CTCAGCGTCTTCGTCTATCAGTTTGAAAAATGGCGGGAGTTTTGTCATAGACGTCACCGGCGGGACCACGACTACGGCGT
CCACGCCGACGACGAGTCCTCAAGGAAGCTGGGATTTAGGATCCGGTTCGAGCTCGGGTTCGAGACCGGCGTCGAGACCG
GGATCAGGATCCGGGTCGGATTTCGGATATCTGCTGCCGCAGCACCCGTCGGCGCAAAACAGAGGGTTCGTGATGTCGGC
TACGGTGGAAGGAGTCGGGAAAAGGAGCAAACCGGAGGTGGAGATCGGGGTGACGCACGTGACATGTACGGAGGACGCAG
CAGCGCACGTGGCATTAGCTGCGGCGGTGGATCTGAGTTTGGATGCTTGCAGGCTTTTCTCAGACAAGCTAAGGAAAGAG
CTTAGACAGCAAAGCCAGCTTGGTGTCGTTTGA