Details for Capsella Locus Carubv10013543m

Position : scaf_3 ( 5`- 9498172 .. 9503417 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013543m

Protein [Map View]
MAMLGAQQVPAAACTPDIVGNAFVHQYYHILHQSPEHVHRFYQEISKLGRPEENGVMSITSTLQAIDKKIMALGYGVISA
EIATVDTQESYGGGVLVLVTGYLTGKDCVRRTFSQTFFLAPQEKGYFVLNDMLRYIDEAAILHANRIPVNIIQTPVNTYQ
DAAPVKGIPNDLVQEKYTQEKHAVKQIEVFSKSINGPEVFTPSEDEQVSATEEAPAPEIVHEASNEVQKGGESDPRTGEL
PKRSYASIVKVMKENAAPMSASRTPTKVEPKKQEDQAIHIPLPTPLSEKSDSGANVAVNENDQDNEKALGPSIYLKGLPL
DATPALLENEFQKFGLIRTNGIQVRSQKGFCFGFVEFESASSMQSAIEASPVMLNGHKVVVEEKRSTARGNYRGRSSFGV
NTGYRNEGGRGRGSFGGGRGGYGRTDFNNGYGNNNRGNNRGGYGNRANGDNGGFPRSNGNNGRVRRGGGVDANRATKPVM
DDANRVTVTA*

DNA
ATGGCGATGTTAGGTGCACAGCAAGTTCCAGCAGCAGCTTGTACTCCAGATATTGTTGGGAATGCATTTGTGCATCAGTA
TTATCACATATTGCATCAATCTCCTGAGCATGTTCACAGGTTTTACCAAGAGATTAGCAAGTTAGGCCGTCCTGAAGAGA
ATGGTGTAATGAGTATCACTTCTACATTGCAAGCTATTGACAAGAAGATAATGGCACTTGGTTATGGTGTTATCAGTGCT
GAGATAGCAACTGTGGACACACAAGAATCTTATGGTGGTGGTGTTCTTGTACTGGTGACTGGGTATTTGACGGGAAAAGA
CTGTGTCAGGAGGACGTTTAGTCAGACCTTCTTCCTTGCTCCACAAGAGAAAGGATACTTTGTCTTGAATGATATGTTAC
GGTACATTGATGAAGCCGCAATCCTTCATGCAAATCGGATTCCAGTGAACATCATTCAAACTCCTGTCAACACTTACCAG
GATGCAGCTCCTGTGAAAGGCATTCCAAATGACCTTGTTCAGGAGAAATATACCCAAGAGAAACATGCTGTTAAGCAAAT
TGAGGTGTTTTCCAAGAGCATTAATGGGCCTGAAGTGTTCACTCCCTCTGAAGATGAACAAGTATCAGCTACAGAAGAAG
CTCCTGCACCTGAAATAGTTCATGAAGCTTCTAATGAAGTGCAGAAGGGTGGAGAATCTGATCCTAGGACTGGCGAACTT
CCAAAGAGATCCTATGCATCCATTGTCAAGGTTATGAAAGAGAATGCTGCACCAATGTCTGCTTCGAGAACCCCAACAAA
GGTGGAACCAAAGAAACAAGAAGACCAAGCCATCCACATCCCTCTACCAACGCCATTGTCTGAGAAATCAGATTCAGGAG
CAAATGTAGCTGTAAATGAGAACGATCAAGATAATGAAAAAGCTCTAGGGCCATCCATCTATCTTAAGGGCTTGCCTCTT
GACGCAACACCAGCCTTGCTTGAAAATGAGTTTCAGAAATTTGGACTTATTAGGACCAATGGAATTCAAGTGAGAAGCCA
GAAGGGATTCTGTTTTGGTTTTGTTGAGTTTGAATCCGCAAGTTCCATGCAAAGCGCAATTGAGGCATCACCTGTCATGC
TCAATGGGCACAAAGTAGTTGTGGAGGAAAAGAGATCTACTGCAAGAGGGAACTATAGAGGACGCTCGTCGTTTGGTGTA
AACACAGGCTACAGAAACGAAGGAGGTAGGGGCCGTGGGAGCTTTGGAGGTGGAAGAGGGGGATATGGCCGGACTGACTT
CAATAACGGATATGGTAATAACAACAGGGGAAACAACAGAGGAGGATATGGAAACCGAGCAAATGGTGACAATGGTGGGT
TCCCAAGGTCCAATGGTAATAACGGACGTGTAAGACGTGGTGGCGGAGTTGATGCTAATAGAGCTACTAAACCCGTGATG
GATGATGCTAATCGTGTGACTGTTACTGCGTAA