Details for Capsella Locus Carubv10013541m

Position : scaf_3 ( 5`- 6272034 .. 6275237 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013541m

Protein [Map View]
MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIA
LDFIDSVIKKNESINGHYKNVKFLCADVTSPDLKITDGSLDLIFSNWLLMYLSDKEVELLAERMLGWIKVGGYIFFRESC
FHQSGDSKRKSNPTHYREPRFYSKVFQECQARDAAGNSFELSMIGCKCIGAYVKNKKNQNQICWIWQKVSSENDRGFQRF
LDNVQYKSNGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMAEKFDVHVVGIDLSVNMISF
ALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEY
IKQRGYDLHDVQAYGQMLKDAGFKDVIAEDRTDQFMQVLRRELERVEKEKEEFIADFSKEDYDDIVGGWKAKLERCASDE
QKWGLFIANKN*

DNA
ATGGCTGCATCCTACGAGGAAGAGCGTGATATCCAGAAGAACTATTGGATTGAGCATTCGGCTGATTTGACTGTTGAAGC
TATGATGCTTGACTCTCGAGCTTCTGATCTCGACAAGGAGGAACGTCCTGAGGTACTCTCTTTACTCCCTCCATATGAAG
GCAAATCTGTCTTGGAGCTTGGAGCAGGAATCGGTAGGTTCACTGGTGAATTGGCTCAAAAGGCTGGTGAACTCATTGCT
CTTGACTTCATTGATAGCGTCATTAAGAAGAATGAAAGCATCAACGGACATTACAAGAACGTCAAGTTTCTGTGTGCTGA
TGTTACGTCCCCTGACCTGAAGATCACTGATGGATCCCTTGACTTGATTTTCTCCAACTGGCTCCTCATGTATCTTTCTG
ACAAAGAGGTGGAGCTTTTGGCAGAAAGGATGCTTGGTTGGATCAAGGTTGGAGGATACATCTTCTTCCGTGAATCTTGC
TTCCATCAGTCTGGGGATAGCAAGCGGAAATCCAACCCAACTCACTACCGTGAACCCCGTTTCTATTCCAAGGTCTTCCA
AGAATGTCAGGCGCGCGATGCTGCTGGAAATTCATTTGAGCTCTCTATGATTGGATGCAAGTGCATTGGAGCTTATGTGA
AGAACAAGAAAAATCAGAATCAGATTTGTTGGATTTGGCAGAAAGTCAGCTCAGAAAATGACAGAGGCTTCCAGCGTTTC
TTGGACAATGTTCAGTACAAATCCAATGGCATCCTACGCTATGAGCGTGTCTTTGGACAAGGGTTTGTGAGCACTGGTGG
ACTTGAGACAACCAAAGAATTTGTGGAGAAAATGAATCTGAAACCAGGACAGAAAGTGTTAGATGTTGGATGTGGCATTG
GTGGAGGTGACTTCTATATGGCTGAAAAGTTTGATGTTCATGTTGTTGGTATCGACCTCTCTGTCAACATGATCTCTTTC
GCATTGGAGCGTGCTATTGGACTCAACTGCTCGGTTGAGTTTGAGGTTGCAGATTGCACCACAAAACACTACCCAGATAA
TTCGTTTGATGTCATTTACAGCCGTGATACTATCCTGCACATCCAAGATAAACCAGCTTTGTTCAGGACTTTCTTCAAGT
GGCTTAAGCCGGGAGGTAAAGTTCTCATCAGTGACTACTGTAGGAGCCCAAAAACTCCATCTGCTGAGTTTTCAGAGTAC
ATCAAACAGAGAGGATATGATCTCCATGACGTTCAAGCTTATGGGCAGATGCTAAAAGACGCTGGCTTTAAAGACGTGAT
TGCAGAGGACCGTACTGATCAGTTTATGCAAGTCCTGAGACGTGAACTAGAGAGGGTGGAGAAAGAAAAGGAAGAATTCA
TCGCCGACTTCTCCAAAGAGGATTATGATGACATTGTCGGAGGATGGAAGGCAAAGCTGGAGAGGTGTGCATCGGATGAA
CAGAAATGGGGACTCTTCATCGCCAACAAGAATTAA