Details for Capsella Locus Carubv10013540m

Position : scaf_3 ( 5`- 5109640 .. 5112218 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013540m

Protein [Map View]
MGESQILLAHSFTTWSCKTLFTLWIVFTLHSFPFQAQAAPAGSLIKHMSWVLKWTTGSSSKISQSDTNVLEFENGYLVET
VVEGNEIGVVPYKIRVSDDGELYAVDEVNSNIMKITPPLSQYSRGRLVAGSFQGKTGHADGKPSDARFNHPRGVTMDDKG
NVYVADTLNLAIRKIGDSGVTTIAGGKSNIAGYRDGPSEDAKFSNDFDIVYVRPTCSLLVIDRGNAALRQISLSEEDCHY
QDDSSISPTDILLVIGAVVIGYATCLLQQGFGNSFFSKTQLETETSFEEEHPGKEKFSRPVLETTATKEEPGWPSFGQLL
IDLCKLALEFITSHLVPTRFKTSPNLRPLKDRLKMPEDEQEPPRVQMHTAPAPVSESRHAHLPKANDYPEHKTSKLRSSS
VMKDPTLSSSKHHRSSSKRQDYAQFYASGEVPQPKVHKERSRRRHRDKTTETEPKPTPSDAVKPVEYSNNSSKFDHFNMR
SSKYGPETPFRF*

DNA
ATGGGGGAATCTCAGATTCTACTCGCTCACAGCTTTACTACCTGGTCTTGTAAGACTCTCTTCACTTTATGGATCGTCTT
TACTCTTCACAGCTTTCCATTTCAAGCTCAAGCTGCTCCTGCTGGTTCGTTGATTAAGCACATGTCATGGGTTCTAAAGT
GGACTACTGGATCATCCTCTAAGATATCTCAATCAGATACTAATGTTCTTGAATTTGAGAATGGTTACTTGGTCGAAACT
GTTGTGGAAGGAAATGAAATTGGTGTTGTTCCTTACAAGATTCGTGTTTCCGATGATGGAGAACTTTATGCTGTTGATGA
AGTTAATAGCAACATCATGAAGATCACTCCTCCCTTGTCCCAGTACAGCAGGGGAAGATTGGTGGCTGGATCGTTTCAAG
GAAAGACGGGGCATGCAGATGGAAAACCTAGTGACGCTCGTTTTAACCATCCGAGAGGAGTAACAATGGATGACAAAGGG
AATGTTTATGTCGCTGATACTTTGAATCTCGCTATCCGAAAGATTGGAGATTCAGGTGTTACTACAATAGCTGGAGGGAA
ATCAAATATAGCTGGCTACAGAGATGGTCCAAGTGAGGATGCAAAGTTCTCAAATGATTTTGATATCGTATATGTTCGGC
CTACCTGCTCGTTGCTGGTCATTGACCGAGGAAATGCAGCTCTTCGCCAAATCTCTCTCAGCGAAGAGGACTGTCACTAT
CAAGATGATAGCTCAATCTCTCCAACTGATATCCTCTTGGTTATTGGTGCTGTTGTCATTGGTTATGCTACTTGTTTGCT
CCAACAGGGTTTTGGAAATTCTTTCTTCTCAAAGACGCAGCTAGAAACAGAAACCAGCTTTGAGGAGGAGCATCCAGGCA
AAGAGAAATTCTCCCGACCTGTCCTTGAGACAACAGCAACCAAGGAAGAACCTGGTTGGCCATCATTTGGGCAACTCCTT
ATTGATCTCTGCAAACTCGCTCTTGAGTTTATAACCAGCCACCTAGTTCCAACCCGATTCAAAACCAGCCCCAATCTAAG
GCCATTAAAAGATAGACTCAAAATGCCTGAGGACGAACAAGAACCACCTAGAGTCCAAATGCATACTGCCCCAGCACCAG
TCTCTGAATCCCGGCATGCCCACTTGCCTAAAGCGAATGATTACCCGGAACATAAGACCTCTAAGCTAAGATCAAGTAGT
GTAATGAAGGACCCTACTTTGTCATCATCCAAGCACCACAGGTCATCATCAAAACGGCAAGACTATGCTCAGTTCTATGC
CTCGGGAGAGGTTCCCCAACCGAAGGTCCATAAAGAGCGATCGAGGCGTCGCCATAGAGATAAAACAACAGAAACAGAAC
CAAAACCAACACCATCGGATGCGGTGAAGCCTGTAGAGTACAGCAATAATAGTTCAAAGTTTGATCATTTCAACATGAGG
AGTAGTAAGTATGGTCCCGAAACTCCATTTCGATTCTAG