Details for Capsella Locus Carubv10013537m

Position : scaf_3 ( 5`- 2857631 .. 2860160 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013537m

Protein [Map View]
QNCRRTQINKTRLKRKSYKIASIASSVSSFKNRVLSDSNVNISFSLSLSLSPEIILLLPSSSRTSISLKSKKLKSREIKS
LNPPSQLMQTLHQSQLLQNSAEPANNQSESDAPPKQVAQAMERLNQAARVIADIRLGADRILEAMFVASQPRHTDMPLQL
FLREDASMRQHLQDLRLIGKKLEESGVLTESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAF
TDQKRRFFPHIDDGLKMEPKSKKLCASHLLLENGREEPVDYKTLPEIQSRLEKLVPDVKVSTYGRLNWLKRANYLLGSNS
DDSTEGSKPIFQSSSKLRSGLQNEIVDKVAVIELSFPSLFRAVVSLNPAGSVDPDAVAFFSPDEGGSYLHARGVSVYHVF
KQITEHAATALQYFLGFGTGTALYSLLLWICSFESLYSKPCSKCGRLVAMDNKSALILPPLLRAYQELPLVVKTGEIDLD
VCEAYHSSCSPDDS*

DNA
CAGAACTGCAGAAGAACGCAGATCAATAAAACGCGTTTAAAACGCAAAAGCTATAAAATTGCGTCTATTGCGTCTAGCGT
TTCCAGCTTCAAAAATAGAGTACTTTCAGACTCGAACGTGAACATCTCTTTCTCTCTCTCTCTTTCTCTCAGTCCAGAAA
TAATCCTCCTCCTTCCGTCGTCGTCAAGAACATCAATTTCATTGAAATCAAAAAAATTGAAATCGAGAGAGATAAAGAGT
CTGAATCCTCCATCACAGCTTATGCAGACACTACACCAGTCCCAACTTCTCCAGAACTCGGCCGAGCCGGCGAACAATCA
GTCAGAATCTGACGCGCCGCCGAAACAGGTGGCTCAGGCCATGGAACGACTTAATCAAGCGGCTAGGGTTATCGCCGATA
TCCGCCTCGGTGCAGACCGTATCCTTGAAGCAATGTTCGTGGCTTCTCAACCTCGTCACACCGATATGCCCCTTCAGCTC
TTCCTCAGAGAAGACGCCTCCATGCGCCAACATCTTCAGGATCTCCGCTTAATCGGGAAGAAGTTGGAAGAATCTGGAGT
GTTAACTGAGTCTCTTAGGTCAAGAAGTAACTCGTGGGGTCTTCACATGCCATTGGTTTGTCCAGATGGTGCAGTCGTTG
CTTATGCTTGGAAAAGACAGCTTGCTGGACAAGCTGGTGCTTCTGCTGTTGATAGAACCAGGTTAGCTCTTAAGGCATTC
ACGGATCAGAAAAGACGGTTCTTCCCTCACATTGATGATGGATTAAAGATGGAACCAAAATCGAAAAAACTTTGTGCCTC
CCATTTGCTATTAGAAAATGGAAGAGAGGAGCCGGTTGATTACAAAACTTTGCCAGAGATACAGTCACGTTTAGAGAAGC
TGGTCCCGGATGTGAAGGTGTCTACTTACGGACGCTTGAACTGGCTGAAGAGAGCTAATTATTTACTTGGGTCAAATAGT
GATGATTCAACAGAAGGATCGAAACCTATTTTCCAGAGTTCCAGTAAACTGAGATCAGGGTTACAGAACGAAATTGTTGA
TAAGGTTGCTGTAATTGAATTATCATTTCCATCTTTATTCAGAGCTGTAGTCTCATTGAATCCAGCTGGTTCTGTTGATC
CAGATGCAGTTGCATTCTTTTCTCCTGATGAAGGAGGTAGCTACTTACATGCGAGAGGAGTCTCAGTTTATCATGTGTTC
AAACAAATCACGGAACATGCTGCTACGGCCTTGCAATATTTTCTCGGCTTTGGTACGGGAACAGCTCTCTATTCTCTTCT
GCTATGGATATGCAGTTTTGAATCCCTATATAGCAAACCATGCAGTAAATGTGGAAGACTAGTAGCAATGGATAATAAGT
CTGCTTTGATCTTACCCCCTCTACTCCGCGCTTACCAGGAACTACCTCTTGTGGTTAAAACTGGGGAAATCGACCTGGAT
GTTTGTGAAGCTTACCACTCCAGTTGCTCTCCAGATGATTCCTAG