Details for Capsella Locus Carubv10013535m

Position : scaf_3 ( 5`- 2537253 .. 2540973 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013535m

Protein [Map View]
MQSDNGKLFIGGISWDTNEERLKEYFGSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITEKHNIDGRLVEAKKA
VPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEE
AVEKVLLKTFHELNGKMVEVKRAVPKELSPGPTRSPLGAGYSYGVNRVNNLLNGYAQGFNPAAVGGYGLRMDGRFSPVGA
GRSGFANYNSGYGMNVNFEQGLPTGFTGGTNFNGNVDYGRGMSPYYIGNTNRFGPAVGYEGGNGGGNSSFFSSVTRNLWG
NNGGLNYNNNTTNSNSNTYMGGSSSGNNTLSGPFGNSGVNWGAPGGGGNNAVSNDNVKFGYGGNGESGFGLGTGGYAARN
PGASKAAPSSSFSSASATNNTGYDAAGLSEFYGNGAVYSDPTWRSPTPEAEGPASFSYGIGGGGPSSDVSARSSSPGYVG
SYSVNKRQSNRGIAT*

DNA
ATGCAATCGGACAATGGAAAGCTTTTCATCGGTGGGATTTCTTGGGACACCAATGAGGAACGTCTCAAGGAGTATTTCGG
CAGTTTCGGAGAAGTGATCGAGGCTGTGATCTTGAAAGATCGCACCACTGGTCGTGCTCGTGGTTTCGGTTTTGTTGTCT
TTGCTGATCCTGCTGTCGCTGAGATTGTTATCACTGAAAAGCATAACATTGATGGCAGATTGGTTGAAGCTAAGAAGGCT
GTTCCCAGAGATGACCAAAACATGGTTAATAGAAGCAACAGCAGTAGCATCCAAGGCTCTCCTGGTGGTCCAGGTCGCAC
TAGGAAGATTTTTGTTGGAGGATTACCTTCTTCCGTTACTGAGAGCGATTTCAAGACGTATTTTGAGCAGTTTGGGACTA
CTACGGACGTCGTTGTTATGTATGATCACAACACACAGAGGCCTAGAGGTTTCGGATTCATAACCTACGATTCCGAGGAG
GCCGTTGAAAAGGTTTTGCTCAAGACGTTCCATGAACTAAATGGTAAAATGGTTGAGGTTAAGCGAGCTGTTCCAAAGGA
GTTATCTCCAGGTCCAACTCGCAGCCCGCTTGGCGCTGGTTACAGCTACGGAGTTAATAGGGTCAATAACCTCCTTAATG
GATATGCTCAAGGATTTAATCCTGCTGCAGTTGGGGGCTACGGACTTAGGATGGATGGTCGTTTCAGTCCTGTTGGTGCT
GGGAGAAGCGGCTTTGCAAACTATAATTCTGGCTACGGGATGAATGTGAACTTCGAGCAGGGATTGCCCACAGGGTTCAC
GGGTGGTACAAATTTCAATGGCAACGTTGACTATGGCCGAGGAATGAGCCCGTACTACATTGGTAACACAAACCGGTTTG
GTCCTGCGGTTGGCTATGAAGGGGGAAACGGAGGAGGAAACTCATCCTTCTTCAGTTCGGTTACACGGAACCTATGGGGA
AACAATGGGGGTCTTAACTATAATAACAACACTACAAACTCAAACTCCAATACATACATGGGAGGATCATCAAGTGGGAA
CAACACACTTAGTGGTCCATTTGGCAATTCGGGAGTCAATTGGGGTGCTCCTGGAGGAGGAGGAAACAATGCTGTTAGTA
ACGATAATGTCAAGTTTGGTTATGGAGGAAACGGTGAATCTGGTTTTGGGTTGGGAACAGGTGGATATGCTGCAAGAAAC
CCAGGGGCTAGCAAGGCAGCACCATCGTCTTCATTCTCTTCTGCCTCAGCAACCAACAACACAGGTTACGATGCAGCAGG
ACTCTCAGAGTTTTACGGGAATGGTGCAGTTTATAGTGATCCCACATGGAGATCACCAACTCCTGAGGCAGAAGGGCCTG
CTTCTTTTAGCTATGGGATTGGAGGAGGAGGTCCTTCTTCAGATGTTTCAGCTAGAAGTTCATCTCCAGGTTATGTTGGC
AGTTACAGTGTGAACAAGAGGCAATCGAACAGAGGAATTGCTACTTAG