Details for Capsella Locus Carubv10013529m

Position : scaf_3 ( 5`- 899190 .. 901456 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013529m

Protein [Map View]
MSSQGEMEERLLSVGSDAKGQSSNNNSESIYLRSKFWSEVNKLWRIALPSSLFRMTSFGSIIVAQAFIGHSSELGLAAYA
LLQSTFIRFLYGLMGGMSSATETLCGQAYGAEQYHTMGIYLQRSWIVDTAVTTLFLPFIVFAGPILRLLGQNVEITKTID
EIYPWMIPYVYSLIFTMTIQMYLQAQMRNAIVGVLSTLSLVLDLLVTWWCVSVMGMGIGGALIGLNVSSWAMVLAEFVYI
FGGWCPFTWTGFSIAAFVDLVPMLKLSISSGVMICLEYWYMSILVLMAGYTKDAKIAISAFSICQYIYTWELNICLGFLG
AACVRVANELGKGDAYAVRFSIKVILTVSILMGVIFSALCLAFCGQISYLFSNSVEVSDAVNDLSIILAVSILLNSIQPI
LSGVAVGAGMQSVVAVVNLASYYAVGIPLGLILTNVFHLGVKGLWSGMLAGIALQTVILCYIIYKTDWELEVKRTSERMK
LWSLKPSNEESNPIKD*

DNA
ATGAGTAGTCAAGGAGAAATGGAGGAGAGGCTATTAAGTGTTGGATCAGATGCTAAGGGTCAGAGCAGTAATAATAACAG
TGAGAGTATCTATTTGAGAAGTAAGTTTTGGAGTGAAGTAAATAAATTATGGAGAATAGCATTACCTTCTTCTTTGTTCC
GAATGACTTCGTTTGGGAGCATCATTGTGGCTCAAGCCTTCATCGGTCACTCCTCTGAGTTGGGTCTTGCTGCTTACGCT
CTCCTCCAAAGCACTTTCATCCGCTTTCTCTACGGTTTAATGGGCGGTATGTCAAGTGCAACGGAGACATTATGCGGGCA
AGCGTACGGTGCAGAACAATACCACACAATGGGGATATATCTACAACGTTCATGGATTGTGGACACGGCCGTGACCACTT
TATTCCTACCTTTTATTGTATTTGCTGGTCCTATTCTTCGTCTATTAGGCCAGAACGTTGAGATCACAAAGACCATTGAT
GAGATCTATCCTTGGATGATCCCGTATGTCTATAGCTTGATTTTCACTATGACTATACAAATGTACCTCCAAGCACAGAT
GAGGAACGCTATTGTAGGCGTTCTCTCAACATTGTCACTGGTTCTTGACCTCCTAGTCACATGGTGGTGCGTGAGTGTTA
TGGGAATGGGGATTGGTGGTGCGCTCATCGGGCTTAATGTGAGCTCGTGGGCGATGGTATTAGCCGAGTTTGTCTACATT
TTTGGTGGATGGTGTCCGTTTACTTGGACCGGATTTAGTATTGCTGCATTTGTTGACCTAGTTCCTATGCTCAAGCTCTC
TATTTCCTCAGGCGTCATGATCTGCTTAGAGTATTGGTACATGAGCATCCTTGTCTTAATGGCTGGGTATACAAAAGATG
CGAAAATAGCAATCTCTGCTTTCTCCATATGCCAATACATATATACATGGGAACTCAACATATGCCTTGGCTTCTTGGGT
GCAGCTTGCGTCCGGGTGGCTAACGAGCTGGGGAAAGGAGATGCATATGCAGTGAGATTTTCAATAAAAGTGATACTCAC
AGTATCGATATTGATGGGAGTGATATTCTCAGCGCTATGCTTAGCTTTTTGTGGTCAGATATCGTATTTGTTTTCGAATA
GCGTTGAGGTCTCAGACGCAGTGAATGATCTATCGATCATCCTAGCCGTTTCAATCTTACTCAACAGCATACAACCTATA
CTATCAGGGGTAGCAGTTGGAGCAGGGATGCAGAGCGTAGTGGCAGTTGTGAACTTAGCTTCGTATTATGCAGTTGGTAT
ACCTTTAGGTCTCATTCTTACTAATGTATTCCATCTTGGTGTTAAGGGACTATGGTCGGGAATGTTGGCTGGAATTGCGC
TCCAAACAGTGATATTGTGCTATATCATTTACAAAACTGACTGGGAACTAGAGGTTAAAAGGACAAGTGAACGTATGAAA
TTGTGGAGCCTCAAGCCATCTAATGAAGAATCGAATCCCATAAAAGACTGA