Details for Capsella Locus Carubv10013526m

Position : scaf_3 ( 5`- 5177945 .. 5181858 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013526m

Protein [Map View]
MRRRNMMTGLDMEPNSQSFVGHPEPCIGTNFLYPDIPPVNTAPHLEAHSLQEPFDNNSMLYGPPQYHHQHASNLSSGMPT
APNFYPPYVNFEAPPSYMMSHGSYGAVDGFTSAEHERNAHFMDHGYKRKSSEVIPPGTSQYPAAAPPCSFLQLNTPETAP
ISFPQFGSYPQVLDQRSVRNRAGAATMDPLLSHGHNNFIQGNYAAHPFPPPGSIWYDQYCNGIRSDGSSSHWSQAPSAPH
MPGTGSIDSGNVYFPRYPETSSSRNPTPSVYPRSHYISHHPLPPPAIVYPHMPSAPYTEAMHATSYSHMGPLQSIGSRIN
QEHPREDFVAAAILRHREMPHLRGIPTDEVALWEVGDFYDDVNYVDHHQAMRLDIEDMSYEELLALSDQIGTVKTGLSEE
DVKNLLKRRTSLATRINLEEAPSTDLEEDSCTICQENYKNQDKIATLDCMHLYHTECLQKWLVIKNVCPICKAEALVTEK
KKLRLSSIGEEVTADSN*

DNA
ATGAGACGCAGAAATATGATGACTGGTTTAGACATGGAGCCGAATTCTCAAAGCTTTGTCGGTCATCCTGAACCTTGCAT
TGGAACTAACTTTCTGTATCCTGATATCCCACCCGTGAACACAGCTCCTCATTTAGAAGCGCATTCTCTGCAAGAACCTT
TTGACAACAACTCAATGCTCTACGGGCCTCCACAGTACCATCATCAACATGCTTCAAATCTTAGTTCTGGCATGCCAACC
GCACCAAATTTTTATCCCCCTTACGTGAATTTTGAAGCTCCACCGAGTTATATGATGTCTCATGGAAGTTATGGTGCAGT
TGATGGATTTACTTCCGCCGAACATGAGAGAAATGCCCACTTTATGGATCACGGATACAAAAGAAAAAGTTCTGAAGTAA
TACCACCTGGAACTTCTCAGTATCCAGCAGCAGCACCTCCTTGTTCTTTCCTTCAGTTGAATACACCGGAGACAGCACCT
ATCTCATTCCCACAGTTTGGTAGTTATCCACAAGTACTAGATCAGAGAAGTGTGAGGAACAGAGCAGGAGCAGCTACAAT
GGATCCACTTCTCTCTCATGGTCATAACAATTTCATTCAAGGAAATTATGCAGCTCATCCTTTTCCACCTCCTGGCTCAA
TCTGGTATGACCAGTACTGTAATGGCATCAGATCTGATGGATCGTCTTCGCATTGGTCCCAAGCACCCTCTGCACCTCAC
ATGCCTGGCACTGGGTCCATAGACTCTGGTAATGTCTACTTCCCAAGATACCCTGAAACATCTAGTAGCAGAAACCCCAC
ACCATCTGTATACCCGAGGAGCCACTATATTAGCCATCACCCGCTACCTCCTCCTGCCATTGTGTACCCTCACATGCCTT
CAGCCCCATACACTGAGGCTATGCATGCTACTTCATACAGTCATATGGGACCCCTTCAATCAATTGGATCCAGAATAAAC
CAAGAACATCCCCGAGAAGATTTTGTAGCTGCAGCAATACTAAGACACCGTGAAATGCCTCACCTAAGAGGAATTCCCAC
AGATGAAGTTGCACTTTGGGAGGTAGGAGACTTCTACGATGATGTTAACTATGTCGATCATCATCAAGCTATGCGCTTAG
ATATAGAGGACATGTCATATGAGGAGCTTCTTGCTTTGAGCGACCAGATTGGAACTGTGAAGACTGGCTTGTCGGAAGAA
GATGTTAAAAATCTTCTGAAAAGAAGAACCTCATTAGCGACCAGAATCAACCTGGAAGAAGCTCCATCTACCGATCTAGA
AGAAGATTCTTGCACAATATGCCAGGAAAACTACAAGAACCAGGATAAGATCGCAACGCTAGATTGCATGCACTTGTACC
ACACAGAATGCTTGCAGAAGTGGTTGGTTATCAAGAACGTGTGCCCAATCTGCAAAGCAGAGGCTCTGGTCACGGAGAAG
AAGAAGCTACGGTTAAGTAGTATAGGAGAAGAGGTTACTGCGGATTCAAACTAA