Details for Capsella Locus Carubv10013524m

Position : scaf_3 ( 5`- 7934646 .. 7939100 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013524m

Protein [Map View]
QKNTKLKNTHTRRRARISPAILMDSVCKNDENSSADVAALLAPLPALQLQEYFQKLINSRGCNGIEVKHNGTTGKGVYAN
SEFQEDELILKDQILVGIQHSSNKVDCLVCSFCFRFVGSIEKQIGRKLFFKNLGLSGCCVGDSSESEEDKSVKYIGNEEQ
CGGSSSSHHTLPEGVVSSLMNGEMALPHADKFPLPSPLSCPGGCQEAFYCSESCAEADWESSHSLLCTGERSASISREAL
GEFIKHANETNDIFILAAKAIAFTILRYRKLKAEHVNKKAKQSGPNHSLLLEAWKPVSIGYKRRWWDCIALPEDVDISDE
GAFRMQIKNLAFTSLELLKTAIFDKECEALFSLEIYGNIIGMFELNNLDLVVASPVEDYFLYIDDLPDADKEKAEEITRP
FLDALGDEFSDFCQGTAFFPLQSCMNHSCCPNAKAFKREEDRDGQAVILALRSISKNEEVTISYIDEELPYKERQALLAD
YGFSCKCSKCLDDSSSV*

DNA
CAAAAGAACACCAAACTAAAAAACACACACACGCGCCGCCGCGCGAGAATATCTCCGGCCATTTTAATGGATTCAGTTTG
CAAAAACGACGAGAATAGCTCCGCCGACGTCGCCGCTCTTCTTGCTCCGCTTCCAGCTCTCCAACTTCAGGAGTATTTTC
AAAAGCTTATAAATAGTAGAGGATGCAATGGAATTGAAGTGAAACACAATGGAACCACTGGGAAAGGTGTTTATGCTAAT
TCAGAGTTTCAAGAAGATGAACTCATTTTGAAAGATCAGATTCTTGTTGGCATCCAGCATTCATCCAACAAGGTGGATTG
TTTGGTTTGCAGTTTTTGTTTCCGGTTTGTTGGATCGATCGAGAAACAAATTGGCCGGAAACTCTTTTTTAAGAATCTTG
GTCTTTCTGGTTGTTGCGTTGGTGATTCATCTGAAAGTGAAGAAGATAAGTCTGTGAAGTACATTGGGAATGAGGAACAA
TGTGGTGGAAGCAGTTCAAGCCATCATACTCTTCCGGAAGGAGTTGTTAGTTCTCTGATGAATGGGGAAATGGCATTGCC
GCACGCTGATAAGTTTCCTTTGCCTTCGCCTCTTTCGTGTCCTGGAGGATGTCAGGAGGCTTTCTATTGTAGTGAATCAT
GCGCAGAGGCAGATTGGGAAAGTTCTCACTCTTTACTTTGCACTGGTGAGAGGTCTGCATCAATATCTCGAGAGGCTCTT
GGAGAGTTTATAAAACATGCTAATGAGACAAATGATATTTTCATCCTGGCTGCCAAGGCGATTGCCTTTACCATTCTAAG
GTACAGGAAATTGAAAGCCGAACACGTGAACAAAAAAGCAAAACAGAGTGGGCCAAATCATTCATTACTCTTGGAGGCAT
GGAAGCCAGTTTCTATTGGATACAAAAGAAGGTGGTGGGACTGCATCGCATTGCCAGAAGATGTTGATATTTCTGATGAA
GGAGCCTTCAGGATGCAAATAAAGAATCTTGCATTTACGTCTTTGGAGCTCCTGAAGACAGCCATATTTGATAAAGAATG
TGAAGCCCTTTTCTCCCTTGAAATCTATGGGAATATCATCGGCATGTTTGAGCTGAATAACCTAGACTTGGTGGTAGCAT
CACCAGTAGAGGACTATTTCTTGTATATTGATGATCTTCCTGATGCAGACAAGGAAAAAGCTGAGGAAATTACAAGACCG
TTTCTAGATGCTCTTGGTGATGAGTTCTCGGACTTTTGCCAAGGAACGGCCTTCTTCCCTCTGCAGAGCTGTATGAACCA
TTCTTGTTGCCCTAATGCAAAAGCCTTCAAACGAGAAGAGGACAGAGACGGACAAGCAGTTATATTAGCGTTAAGAAGCA
TCAGCAAGAACGAAGAGGTGACGATTTCGTATATAGACGAGGAGCTTCCGTACAAAGAGAGACAAGCATTACTTGCAGAC
TATGGTTTCAGCTGCAAGTGCTCGAAGTGTCTGGACGATTCTTCATCAGTTTGA