Details for Capsella Locus Carubv10013523m

Position : scaf_3 ( 5`- 4189084 .. 4191608 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013523m

Protein [Map View]
MSLYLLSESSSGYALFQVQGVDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPSQSALDALNQISAISEGYMTDELRSFLE
LNLPKVKEGKKPKFSLGVAEPKIGSCIFEATKIPCQSNEFVHELLRGVRQHFHRFIKDLKPGDLEKAQLGLAHSYSRAKV
KFNVNRVDNMVIQAIFLLDTLDKDINSFAMRVREWYSWHFPELVKIVNDNYLYARVSKIIEDKSKLSEEHIPMLTEVLGD
EDKAREVVEAGKASMGQDLSPLDLINVQTFAQRVMDLADYRKKLYDYLVTKMSDIAPNLAALIGEMVGARLISHAGSLTN
LAKCPSSTLQILGAEKALFRALKTRGNTPKYGLIFHSSFIGRASAKNKGRIARFLANKCSIASRIDCFADSSSTAFGEKL
KEQVEERLEFYDKGVAPRKTVDVMKEVMENLEKKDEGEKTVEVSEKKKKRKTENKEEEEEKSKKKKKKSKAGEEEELTTT
DNGHSKKKKKTKSQDAE*

DNA
ATGTCACTGTATCTTCTTAGCGAATCATCCTCCGGCTACGCATTGTTCCAGGTACAAGGTGTAGATGAGATTGGACAGAA
CACGGAGGCGGTTCGGAGCTCCGTCTCGGACCTTAGTCGGTTCGGGCGGGTCGTCCAGCTCACTGCGTTTCACCCATCAC
AGTCTGCACTCGATGCTCTCAACCAAATCAGCGCCATCTCTGAAGGGTATATGACTGATGAGCTGAGAAGTTTTCTGGAG
CTGAATCTCCCGAAAGTGAAGGAAGGAAAGAAGCCAAAGTTTAGTTTGGGAGTGGCTGAGCCAAAAATCGGGTCTTGCAT
ATTTGAAGCCACAAAAATTCCTTGCCAGAGCAATGAGTTCGTCCATGAGCTTCTTAGAGGTGTGCGCCAGCATTTCCATA
GGTTCATCAAAGACCTAAAGCCTGGTGATCTGGAAAAAGCTCAACTTGGACTAGCTCACAGTTACAGCAGAGCAAAGGTG
AAGTTCAATGTTAACCGGGTGGATAACATGGTTATTCAAGCTATTTTCCTGCTTGACACGCTTGATAAGGATATCAATTC
CTTTGCTATGAGAGTCAGGGAATGGTACTCGTGGCACTTCCCTGAACTTGTCAAGATAGTAAATGACAACTACCTTTATG
CACGAGTGTCAAAGATTATCGAGGACAAGTCGAAGTTGTCTGAAGAGCACATCCCAATGCTTACTGAAGTCTTGGGGGAT
GAAGACAAGGCAAGAGAGGTTGTTGAAGCTGGAAAAGCATCCATGGGCCAGGATTTATCACCCCTTGATCTGATCAATGT
CCAGACCTTTGCTCAGAGAGTGATGGACCTCGCAGATTACAGGAAGAAGCTCTATGATTATCTTGTTACTAAAATGAGCG
ACATTGCTCCAAATTTGGCAGCCTTGATCGGAGAGATGGTTGGTGCTAGGTTAATTTCACATGCAGGAAGTCTGACAAAT
CTTGCCAAATGCCCATCTTCAACTCTCCAGATTCTCGGTGCTGAGAAGGCACTTTTCAGGGCGCTAAAAACACGTGGAAA
CACACCCAAATATGGTCTAATATTCCATTCGTCATTCATTGGACGTGCATCTGCTAAAAACAAGGGCCGTATTGCTCGTT
TCCTTGCAAACAAGTGTTCCATTGCATCCCGGATTGATTGTTTCGCTGATAGCAGCAGTACAGCTTTCGGTGAGAAACTA
AAGGAACAAGTGGAGGAACGACTTGAGTTTTATGACAAGGGTGTTGCCCCACGTAAGACTGTTGATGTAATGAAAGAAGT
GATGGAAAATCTTGAGAAGAAAGATGAGGGAGAAAAAACAGTGGAGGTCTCAGAGAAGAAAAAGAAGAGAAAGACAGAAA
ATAAAGAGGAGGAAGAAGAGAAATCAAAGAAAAAGAAGAAGAAGAGCAAAGCAGGAGAAGAAGAGGAATTGACAACAACA
GATAATGGTCACAGCAAGAAGAAGAAGAAAACTAAGTCACAAGATGCTGAATAA