Details for Capsella Locus Carubv10013522m

Position : scaf_3 ( 5`- 2074709 .. 2078787 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013522m

Protein [Map View]
MAKQEEVSVPIFTSLEPVYGEGSQLQEATRRFDVLMATFNHIFGASPQLFARSPGRVNLIGEHIDYEGYSVLPMAIRQDT
IITIRKCDDQKKQLRIANVNDKYTMCTYPADPDQEIDLQNHKWGHYFICAYKGFHEYAKSKGVNLGSPVGLDVLVDGIVP
TGSGLSSSAAFVCSATIAIMAVFGQNFEKKELAQLTCECERHIGTQSGGMDQAISIMAKTGFAELIDFNPVRATDVKLPD
GGSFVIAHSLAESQKAVTAAKNYNNRVVECRLASIILGVNLGMEPNEAISKVKTLSDVEGLCVSFAGDRGSSDPLLAVKE
YLKEEPYTAEEIEKILEEKLPSILNNDPTSLAVLNAATHFKLHQRAAHVYSEARRVHGFKDTVYSNLSDEEKLKKLGDLM
NKSHHSCSVLYECSCPELEELVQVCRENGALGARLTGAGWGGCAVALVKESGVTQFISAVKEKYYTKRVEKGVVKEEDME
LYLFASKPSSGAAIFNL*

DNA
ATGGCGAAACAAGAAGAAGTATCGGTACCGATCTTCACATCACTTGAGCCTGTCTACGGCGAAGGATCTCAGCTCCAAGA
AGCTACGCGACGATTCGATGTTTTGATGGCCACTTTCAATCACATCTTCGGTGCTTCTCCCCAACTCTTCGCTCGCTCTC
CTGGAAGAGTGAATTTGATAGGAGAGCACATTGACTATGAAGGTTACTCAGTGTTGCCAATGGCTATTCGTCAGGATACA
ATTATAACGATTAGGAAATGTGATGATCAGAAAAAGCAGCTTCGTATTGCAAATGTTAATGATAAGTACACTATGTGTAC
ATACCCTGCTGATCCTGACCAGGAAATTGACTTGCAGAATCACAAATGGGGTCATTACTTCATATGCGCATACAAAGGTT
TCCATGAGTATGCAAAGTCAAAAGGTGTGAATCTTGGTTCACCAGTTGGACTTGATGTGCTTGTTGATGGAATTGTTCCC
ACAGGTTCTGGGTTGTCAAGTTCTGCTGCATTTGTTTGCTCAGCAACAATTGCTATTATGGCTGTCTTTGGGCAAAACTT
TGAAAAGAAAGAACTTGCACAGCTTACATGTGAATGTGAACGACACATTGGAACACAGTCTGGTGGGATGGACCAGGCAA
TATCTATTATGGCTAAAACTGGATTTGCTGAGCTTATTGACTTCAACCCAGTCCGCGCAACTGATGTGAAACTCCCTGAT
GGAGGGAGTTTTGTAATTGCACATTCTCTTGCAGAGTCACAGAAGGCCGTCACGGCTGCTAAGAATTACAATAACAGGGT
CGTTGAATGTCGACTTGCTTCGATCATACTTGGTGTTAATCTCGGAATGGAACCAAACGAAGCTATATCAAAAGTTAAGA
CTCTCTCTGATGTGGAAGGATTATGTGTGTCATTCGCTGGTGATCGTGGGTCATCTGATCCTCTTCTCGCTGTTAAGGAA
TATCTGAAAGAAGAACCATACACTGCTGAGGAGATTGAGAAAATCCTGGAGGAAAAATTACCTTCAATCTTGAATAATGA
TCCAACATCTTTGGCTGTACTCAATGCTGCCACGCATTTCAAACTGCATCAGAGAGCTGCACACGTTTATTCAGAAGCCC
GGAGGGTTCATGGTTTCAAGGACACAGTCTATTCAAACTTGAGTGACGAAGAGAAGTTAAAGAAACTCGGTGATCTCATG
AATAAAAGCCATCACAGCTGCAGTGTCCTATACGAGTGCAGTTGCCCCGAGCTAGAAGAACTGGTTCAAGTTTGCAGGGA
GAATGGAGCACTTGGAGCAAGACTGACGGGAGCTGGATGGGGTGGGTGCGCAGTGGCCTTGGTTAAGGAATCTGGTGTTA
CTCAATTCATTTCCGCAGTCAAGGAGAAATACTACACAAAGAGAGTAGAAAAAGGAGTTGTAAAGGAAGAAGATATGGAG
CTTTACCTATTTGCCTCCAAGCCTTCAAGTGGTGCTGCCATCTTCAACCTCTAA