Details for Capsella Locus Carubv10013512m

Position : scaf_3 ( 5`- 741932 .. 744198 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013512m

Protein [Map View]
MDFDSLPRRDLQFFCKRNKIPANMTNIAMADALKALEIVEGVDDFMNQSPMSVARTAARTTRKKASKDDTQSSDLVTRSC
YVASKSLAGEMEQENRDTNMLLNPPVSRTSAAATSVAVKLDVTDDMPEVNVSKTPAVRTTRRAQAAASCKKDESVQRVYS
TRRSVRLLEESMADLSLKSNVPAKKHEVAEKEDSPAGSKYQAKSDENSENVKEVEVVSVRDLNDSLEKEWDGSKNDPDLD
VLYGDLGDITFFDASTSKEQLNGADSSTLSASDSFVLVQEQETSEENDFVVVDHAASTTTTNTLVCNKESESEQMKIDSE
SESEETEDETDPGEGDDFGDTNQEAFESRVSASANVSKVDSVTSVVIAEEELEVDSDEWSDYEIGEVELEENSYGSEESI
DIESEEAPVSDKKTPASSSSSSEAESILKSDKNKEDAVEMDLNNNGDGEGEAEAKKKTKKKKKIVAEESFKDVSMRQLTK
MVRELAIKNKQQQHKGATATE*

DNA
ATGGATTTCGACAGTCTTCCGAGAAGAGATCTTCAGTTTTTCTGTAAAAGGAACAAAATCCCAGCCAATATGACCAATAT
CGCCATGGCTGATGCTCTCAAAGCTCTTGAGATTGTTGAAGGTGTTGATGACTTCATGAATCAATCTCCAATGAGTGTAG
CTCGAACTGCAGCTAGAACAACTCGAAAAAAGGCCTCCAAAGATGATACTCAGTCATCAGATTTGGTGACCCGTTCTTGT
TATGTGGCGAGTAAGTCCCTTGCTGGAGAAATGGAGCAAGAAAACAGAGACACGAATATGCTCCTGAATCCACCAGTAAG
CCGTACAAGTGCAGCAGCGACCTCTGTTGCTGTAAAGTTAGACGTCACCGATGACATGCCTGAGGTCAATGTGAGCAAAA
CTCCTGCGGTGAGAACCACAAGAAGGGCTCAAGCAGCTGCTTCTTGTAAGAAGGATGAGTCAGTCCAGAGGGTCTACAGC
ACCAGGAGGTCTGTCAGATTGCTAGAAGAATCCATGGCTGACCTGAGTTTGAAATCCAATGTACCTGCAAAGAAGCACGA
AGTTGCTGAAAAAGAAGATTCACCCGCAGGTTCCAAATACCAGGCAAAATCAGATGAGAACTCAGAAAATGTAAAGGAGG
TTGAAGTTGTGTCAGTGAGAGATTTGAATGATTCTTTGGAGAAGGAATGGGATGGTTCAAAGAATGATCCTGATCTTGAC
GTATTATATGGTGATCTTGGTGATATCACTTTCTTTGATGCGTCCACTAGTAAGGAACAGTTGAATGGAGCAGATTCCAG
CACGCTTTCAGCTTCGGACAGTTTTGTTCTAGTCCAAGAACAAGAAACATCGGAGGAGAATGATTTTGTTGTTGTAGACC
ATGCTGCATCTACTACCACCACAAACACTCTGGTCTGCAACAAAGAATCAGAGTCTGAACAAATGAAGATTGATTCTGAA
TCTGAATCAGAAGAAACAGAAGATGAAACTGATCCAGGGGAGGGTGATGATTTCGGTGACACAAACCAAGAGGCATTTGA
GTCTAGAGTCTCTGCTAGTGCGAATGTGAGTAAGGTAGACTCGGTCACCTCAGTTGTGATAGCTGAGGAGGAACTTGAAG
TAGACAGCGATGAATGGTCCGATTATGAGATAGGCGAGGTAGAGTTGGAGGAAAACAGTTACGGATCCGAAGAGTCCATT
GACATTGAATCAGAAGAAGCTCCTGTTTCAGATAAGAAGACTCCAGCTTCTTCTTCTTCTTCTTCTGAAGCAGAATCAAT
CTTAAAGAGCGACAAGAACAAGGAGGATGCTGTGGAGATGGATCTTAACAACAATGGAGATGGAGAAGGAGAGGCCGAGG
CTAAGAAGAAGACAAAGAAGAAGAAGAAGATAGTTGCTGAAGAGAGCTTCAAAGACGTGAGCATGAGGCAACTAACGAAG
ATGGTGAGAGAACTTGCTATCAAGAATAAGCAACAACAACACAAGGGCGCCACAGCCACTGAGTAA