Details for Capsella Locus Carubv10013511m

Position : scaf_3 ( 5`- 8035367 .. 8038405 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013511m

Protein [Map View]
MEACCSDLEVDINGEETLFLNKQIICAYSATFKKLLGKSSCSNGNLKVIFNDFPGGAQSFELVSRFCYSNGRLAVMPSNV
VLMHCAAKFMEVSKVLEQTEKCMEEVRYWSWPEILLSLKQCQEVETSPEAESLAAKLMDALVEKLCLTVEMSPSSAASAC
SPDSSLFRFSCDSKSTESFKNSSVRLMWWFDEVLVLSPGLVEMFLKLLVSRKFDNLIISRFLFYYQKVKFCSASSHEKRK
ILETIIATLCVLDQSCIPCKGLFGFLRLALGLNISKSSMNKLELMIGNNLDQATLDNLLVPSPSKSSHLYYVNLVIRFTK
AFLDGAKGGLQLKKVSSLIDQYIAEVAPDPCLKPSKFLSLLTLVPDSARDSHEEIYRAIDMYLEAHTGLTNGEKLSVIRT
LSYEKLSGESRTKISRNPKFQVIETPDEQQQQQQKQLILQMDKVEISGENEKLKDHIEGIQWRVMELERACLKMQNQMEV
IKRRSKNSSKGNSRSLPKLCS*

DNA
ATGGAAGCTTGTTGCTCTGATCTTGAAGTTGACATCAATGGAGAAGAAACTCTCTTTCTCAATAAGCAAATCATATGTGC
ATATTCTGCAACATTCAAGAAGCTTCTTGGGAAATCGAGTTGTTCCAATGGAAATCTCAAGGTGATCTTTAATGATTTCC
CTGGTGGAGCGCAAAGTTTTGAGCTTGTATCGAGATTTTGCTACAGTAACGGTCGATTAGCTGTGATGCCCTCGAATGTA
GTCCTTATGCATTGTGCTGCTAAGTTTATGGAAGTCTCTAAAGTCTTGGAACAAACAGAGAAGTGTATGGAAGAGGTTCG
GTATTGGTCTTGGCCAGAGATTCTTCTCAGTCTGAAACAGTGTCAAGAAGTTGAAACATCGCCTGAAGCTGAGTCATTAG
CTGCGAAACTGATGGATGCGCTAGTGGAGAAACTGTGTTTAACTGTTGAAATGAGTCCTTCTAGTGCTGCTTCTGCTTGT
TCACCGGATAGCAGCTTGTTTCGGTTCTCTTGTGACAGTAAAAGCACAGAGAGTTTCAAGAATAGCTCTGTTCGGTTAAT
GTGGTGGTTTGATGAGGTTCTTGTTTTAAGTCCTGGTTTGGTTGAAATGTTCTTGAAGCTGTTGGTCTCACGGAAATTCG
ATAATCTCATCATAAGTAGGTTCTTGTTCTATTACCAGAAGGTCAAGTTTTGCTCTGCATCTTCTCATGAGAAAAGAAAG
ATTCTTGAAACCATCATTGCTACTCTTTGCGTCTTAGATCAAAGCTGTATACCTTGCAAGGGCCTCTTCGGATTTTTGAG
GCTTGCTCTTGGATTGAACATAAGCAAGAGCAGCATGAACAAGCTGGAGCTTATGATAGGTAACAACCTGGATCAAGCAA
CACTAGACAATCTTCTTGTTCCATCTCCATCGAAATCGAGTCACTTGTACTATGTGAATCTCGTTATTAGATTCACGAAA
GCTTTCCTCGACGGAGCAAAAGGAGGGTTGCAATTGAAGAAAGTCTCAAGCTTGATTGATCAATACATAGCTGAAGTAGC
ACCTGACCCTTGCTTGAAACCTTCAAAGTTTCTGTCTCTCCTCACACTTGTTCCAGATTCAGCCAGAGATTCTCACGAAG
AAATTTATCGTGCTATCGATATGTATCTTGAGGCTCACACTGGATTAACCAATGGCGAAAAACTCAGCGTGATACGAACA
TTAAGTTACGAGAAGCTTTCAGGAGAATCAAGAACTAAAATTTCACGTAACCCGAAGTTTCAGGTGATTGAGACACCAGA
TGAACAACAACAACAACAACAGAAGCAGCTCATACTCCAAATGGACAAGGTTGAGATTTCAGGAGAAAATGAGAAGCTGA
AAGATCATATTGAAGGGATACAGTGGAGGGTTATGGAATTAGAGAGAGCATGTTTGAAGATGCAGAATCAAATGGAAGTT
ATCAAGAGGAGATCCAAGAACTCAAGTAAAGGAAACAGCAGATCGCTCCCTAAGCTCTGTTCTTGA